(data stored in ACNUC1104 zone)

EMBL: AM420293.PE530

AM420293.PE530       Location/Qualifiers
FT   CDS_pept        597381..598262
FT                   /transl_table=11
FT                   /locus_tag="SACE_0539"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /function="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99885"
FT                   /db_xref="GOA:A4F761"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4F761"
FT                   /protein_id="CAL99885.1"
FT                   /translation="MQMQHHFTVPVPVDVAWKALLDPERVAPCMPGATLTKSEGNEFAG
FT                   TVKVKLGPVSLLYKGTGTFTEVDEEGRRAVIEASGKDSRGNGTAAATVTAVLTAEDGGT
FT                   SVQVDTDLKITGKPAQLGRGLISEVGGKILNQFAGCLSEKLAGEPEAAGEPEASASTGE
FT                   TATTGDADGVPASEPSGSSVNGDRSSVARAAGEDAAAASESAQRETAARTRRPGWRVTS
FT                   PSEEGQWSSTAQETAANRADAVVTGKPMPSDEAIDLLGTAGAPVLKRVAPIAAAVVGLL
FT                   IVLRLIRRRRRG"
     gtgcaaatgc agcaccactt caccgttccg gtgcccgtcg acgtggcctg gaaggcattg        60
     ctcgatccgg aacgggtggc cccgtgcatg ccgggtgcca ccctcaccaa gtccgagggc       120
     aacgagttcg ccggcaccgt gaaggtcaag ctcggaccgg tgtcgctgct ctacaaggga       180
     accggcacct tcaccgaggt cgacgaggag ggcaggcgcg ccgtcatcga ggccagcggc       240
     aaggactcgc gcggcaacgg caccgccgcc gcgaccgtga ccgcggtgct gaccgccgag       300
     gacggcggca cgtcggtgca ggtcgacacc gacctgaaga tcacgggcaa gcccgcccag       360
     ctcgggcgcg gtctgatctc cgaggtcggg ggcaagatcc tcaaccagtt cgcgggctgc       420
     ctgtccgaga agctcgcggg cgagccggag gccgcgggcg agccggaggc ctccgcgtcg       480
     accggggaga ccgcgacgac cggggacgcc gacggcgttc cggcgagcga gccctcgggc       540
     agctcggtca acggcgaccg cagctcggtg gcccgcgccg cgggcgagga cgccgctgcc       600
     gcgtcggagt ccgcccagcg cgagaccgcc gcgcggaccc gccgtccggg ttggcgggtc       660
     acctcgccgt cggaggaggg ccagtggtcg agcaccgcgc aggagacggc cgccaaccgc       720
     gcggacgcgg tcgtgaccgg caagccgatg ccgtccgacg aggccatcga cctcctcggc       780
     acggcgggcg cgccggtgct caagcgcgtc gccccgatcg cggccgccgt cgtcggcctg       840
     ctgatcgtcc tgcgcctcat ccgccgcagg cggcgcggct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page