(data stored in SCRATCH zone)

EMBL: AM420293.PE535

AM420293.PE535       Location/Qualifiers
FT   CDS_pept        complement(600922..601515)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99890"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:A4F766"
FT                   /protein_id="CAL99890.1"
FT                   /translation="MSAEQHGTTVGGAHRFVGLAENLERHAGRPTGAEPPNVRGDNRGF
FT                   ALVFFHLERYHLTTVISSGLRFQPLGAEPAQELACTVYKEQAEAARHLVDMTAELLVNQ
FT                   RTHLVPDQIVPNEQPLLPHTEFHGVLASGHPLFPPEFTRFTDPEGVEQLQVFTLLPVTL
FT                   GELNFILDNGVTALRQQWARFEVDVFDLGRPSVA"
     atgagcgccg agcagcacgg gaccactgtg ggtggtgcgc accggttcgt ggggctcgcg        60
     gagaacctgg aacgccacgc cggacggccg accggtgccg agccgccgaa cgtgcggggc       120
     gacaaccgcg gcttcgcgct ggtgttcttc cacctggagc gctaccacct gaccacggtg       180
     atcagcagcg gcctgcgctt ccagccgctg ggcgccgagc ctgcgcagga gctggcgtgc       240
     acggtctaca aggagcaggc ggaggcggcc aggcacctgg tcgacatgac cgccgagctg       300
     ctggtcaacc agcgcaccca cctggtgccc gaccagatcg tgcccaacga gcagccgctg       360
     ctgccgcaca ccgagttcca cggtgtgctg gccagcgggc acccgctgtt cccgccggag       420
     ttcacccgct tcaccgaccc cgagggcgtc gagcagctcc aggtcttcac gctgctgccg       480
     gtgacgctgg gcgagctgaa cttcatcctc gacaacggcg tcaccgcgct gcggcagcag       540
     tgggcgcgct tcgaggtcga cgtcttcgac ctcgggcggc ccagcgtcgc gtag             594
//

If you have problems or comments...

PBIL Back to PBIL home page