(data stored in ACNUC1104 zone)

EMBL: AM420293.PE54

AM420293.PE54        Location/Qualifiers
FT   CDS_pept        75994..77856
FT                   /transl_table=11
FT                   /locus_tag="SACE_0056"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /function="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99409"
FT                   /db_xref="GOA:A4F5T5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5T5"
FT                   /protein_id="CAL99409.1"
FT                   /translation="MLGAMRWLLQPAAPDSEGLVEAAPTLRVREVFRRFWPDARPFWGW
FT                   MVLSLVLVLLSPLLDGAAIWLFKIVIDDVLTPRDFALFPAVAAAYAGITILGGAIDFAS
FT                   SYLTVWIGENFLHRMRTRVFAHLHTLSVGFFDRRRLGDTISRLTGDVGAIESLVLSGIS
FT                   QTVSSLVKVVVFAGVIFYLDWRLALVALVAVPLFLWVARFFSRRIKIASREVRGRSGSI
FT                   TTVAEESLGNAPLIQAYGREQAEVGRFYRQSIGNVRAELATARIGAMFSPLVDLVEVLG
FT                   VMAILGVGIWELASNRISLGGLLAFLVYLSQLYTPVRSLGQLANTVFEASAGAERIAEL
FT                   LDQKPHVRTPDKPVRIGRTEGTLSVEQVGFRYPDTGVDVLSGISFQALPGTTTAVVGAS
FT                   GAGKSTLTKLLLRFYDPTEGRIRLDGHDLRELDLSELRSNIAIVLQETLLLDGTIAENI
FT                   RAGKADADDREVVEAARAADAHEFILDLPDGYDTRVGQRGRLLSGGQRQRIAIARAMIR
FT                   DAPLLLLDEPTTSLDAEASKRVLGPLRRLMSGRTTIVISHNLLTVADANHIVYLDHGRI
FT                   VEAGTHAELLANDSGYANLYRLHHPAEVRPNGSSSGKAERWVRP"
     gtgctggggg cgatgagatg gctgctgcag ccggcggcgc cggattccga aggtctggtc        60
     gaggccgcgc cgacgttgcg cgtgcgggag gtgttccgcc ggttctggcc ggacgcgcgc       120
     ccgttctggg gctggatggt gctcagcctg gtgctggtgc tgctgtcccc gctgttggac       180
     ggcgcggcga tctggttgtt caagatcgtc atcgacgacg tgctcacccc gcgggacttc       240
     gcgctgttcc cggcggtcgc cgccgcctac gcgggcatca cgatcctggg cggggcgatc       300
     gacttcgcct cctcctacct cacggtctgg atcggcgaga acttcctgca ccggatgcgg       360
     acccgggtgt tcgcccacct gcacaccctc tcggtcggct tcttcgaccg caggcggctc       420
     ggcgacacca tcagcaggct caccggtgac gtcggggcca tcgagagcct ggtgctctcg       480
     gggatctcgc agaccgtctc ctcgctggtc aaggtcgtcg tcttcgccgg ggtgatcttc       540
     tacctcgact ggcggctggc cctggtggcg ctggtggcgg tgccgctgtt cctctgggtg       600
     gcccggttct tctcccggcg tatcaagatc gcctcccgcg aggtgcgggg gcgcagcggc       660
     tccatcacca ccgtcgccga ggagagcctc ggcaacgccc cgctcatcca ggcctacggc       720
     cgcgagcagg ccgaggtcgg ccgcttctac cggcagagca tcggcaacgt ccgggcggag       780
     ctggcgaccg cgcgcatcgg ggcgatgttc tcgccgctgg tcgacctggt cgaggtcctg       840
     ggcgtgatgg cgatcctcgg tgtcggcatc tgggagctgg cgtcgaaccg catcagcctg       900
     ggcggactgc tcgccttcct ggtgtacctg tcccagctct acacgccggt gcgcagcctc       960
     gggcagctcg ccaacaccgt gttcgaggca tcggccggtg ccgagcgcat cgccgagctg      1020
     ctcgaccaga agccgcacgt ccggacgccg gacaaaccgg tccgcatcgg ccggaccgag      1080
     ggaacgctga gcgtcgagca ggtcggcttc cgctacccgg acaccggcgt cgacgtgcta      1140
     tccggcatca gcttccaggc gctgccgggc acgacgacgg cggtggtcgg cgccagcggt      1200
     gcgggcaagt ccacgctcac caagctgctg ctgcgcttct acgacccgac cgagggccgc      1260
     atccggctcg acggccacga cctgcgcgag ctggacctga gcgagctgcg gtccaacatc      1320
     gccatcgtgc tgcaggagac gctgctgctg gacgggacca tcgccgagaa catccgggcg      1380
     ggcaaggccg acgccgacga ccgcgaggtg gtcgaggcgg ccagggcggc cgacgcgcac      1440
     gagttcatcc tcgacctgcc cgacggctac gacacccgcg tcggccagcg gggcaggctg      1500
     ctctccggcg gacagcgcca gcgcatcgcc atcgcgcggg cgatgatccg cgacgcaccg      1560
     ctgctgctgc tggacgagcc gacgacgagc ctcgacgccg aggcgagcaa gcgcgtgctc      1620
     ggcccgctgc ggcggttgat gtccgggcgc acgacgatcg tcatctcgca caacctgctc      1680
     accgtcgccg acgccaacca catcgtctac ctcgaccacg gcaggatcgt cgaggcgggc      1740
     acgcacgccg agctgctggc caacgacagc ggctacgcca acctctaccg gctgcaccac      1800
     ccggcggagg tgcggccgaa cgggtcctcg agcgggaagg ccgagcgctg ggtccggccc      1860
     tga                                                                    1863
//

If you have problems or comments...

PBIL Back to PBIL home page