(data stored in SCRATCH zone)

EMBL: AM420293.PE540

AM420293.PE540       Location/Qualifiers
FT   CDS_pept        604725..605462
FT                   /transl_table=11
FT                   /locus_tag="SACE_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99895"
FT                   /db_xref="GOA:A4F771"
FT                   /db_xref="UniProtKB/TrEMBL:A4F771"
FT                   /protein_id="CAL99895.1"
FT                   /translation="MSYPPQPGQYGPQQGWGPQQPPQDGSQDFWRQVAGGTGGPQPPYP
FT                   PQPPKKSNTGLIIGLAAGGAALVLVVVVILVFALNGGRDDNQAGGETGGGTSPTTSKTR
FT                   PTTTSSETGSGIEVGDCVALSVQSGGSLTEEPCGSADSDYEIVEVKSGEDKNGCPDNYS
FT                   NTYSGDTYCMVLDVVVGDCLTGYSEDDSVLPLKEECASPAAVDQVTKVDTNPTAEQVCK
FT                   PEEGWYSFQDPPFTACFADKKPA"
     gtgagctacc cgccgcagcc aggacagtac ggcccgcagc aggggtgggg accgcagcag        60
     cccccgcagg acgggtcgca ggacttctgg cgccaggtgg ccggtggcac cggcgggccg       120
     cagccgccct acccgccgca gccgccgaag aagagcaaca ccggcctgat catcggcctc       180
     gccgccggtg gcgcggcgct ggtcctcgtg gtcgtcgtga tcctcgtgtt cgcgctgaac       240
     ggtggcaggg acgacaacca ggccggcggt gagaccgggg gcggcacctc gcccacgacg       300
     tccaagaccc ggccgaccac cacctccagc gagacaggct cgggcatcga ggttggcgac       360
     tgcgtcgcgc tgtcggtcca gtccggcggc tcgctcaccg aggagccctg cggcagcgcc       420
     gactccgact acgagatcgt cgaggtcaag agcggcgagg acaagaacgg ctgcccggac       480
     aactacagca acacctacag cggcgacacc tactgcatgg tcctcgacgt cgtggtcggc       540
     gactgcctga ccgggtacag cgaggacgac tcggtcctgc cgctgaagga ggagtgcgcg       600
     tccccggccg cggtggacca ggtgaccaag gtcgacacca acccgaccgc ggagcaggtg       660
     tgcaagccgg aggagggctg gtactccttc caggacccgc cgttcacggc ctgcttcgcc       720
     gacaagaaac ccgcctga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page