(data stored in SCRATCH zone)

EMBL: AM420293.PE541

AM420293.PE541       Location/Qualifiers
FT   CDS_pept        605676..606476
FT                   /transl_table=11
FT                   /locus_tag="SACE_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99896"
FT                   /db_xref="GOA:A4F772"
FT                   /db_xref="UniProtKB/TrEMBL:A4F772"
FT                   /protein_id="CAL99896.1"
FT                   /translation="MTYPPQQQGPYGQPGRPQGYPQQPGFPQSGPQAVPGQAWGAPQYG
FT                   PVGAGYPTQTGQVPPGQAPHAQMPPGQVPPGQVPPQGQGFGPPPVPPQPSKGGGGALAA
FT                   KIISGVVALAVVGLILLGINMVSGSGAPEAGECLNLTNNSTVNPDWEVAPCGSADSDFV
FT                   IAKQLGGSESCGEDFSEVSKSGRRTSGYTLCLVPDVKAGDCMNIPQYMGLEEKVACGDA
FT                   DANMEILSVENSTAGESACDYDQEFQYIVYNEPAPGRTICMKQV"
     gtgacgtatc caccgcagca gcaggggccg tacggtcagc ccggccggcc ccagggatat        60
     ccgcagcagc ccgggttccc gcagtccggg ccgcaggccg tgccggggca ggcgtgggga       120
     gcgccccagt acggcccggt cggcgccgga tacccgaccc agacgggcca ggtcccgccg       180
     ggccaggccc cgcacgcgca gatgcctccc ggtcaggtcc cgccgggtca ggtgccgccg       240
     cagggccagg ggttcggtcc gccgccggtg ccgccgcagc cgtccaaggg cggtggcggt       300
     gcgctcgcgg cgaagatcat cagcggtgtg gtggccctcg ccgtggtcgg cctgatcctg       360
     ctgggcatca acatggtcag cggcagcggt gctcctgagg ccggtgagtg cctcaacctc       420
     accaacaaca gcaccgtcaa ccccgactgg gaggtcgcgc cctgcgggtc ggcggactcc       480
     gacttcgtga tcgccaagca gctcggcggc tccgagtcgt gcggggagga cttctccgag       540
     gtcagcaaga gcgggcgccg caccagcggc tacacgttgt gcctggtccc cgacgtcaag       600
     gccggcgact gcatgaacat cccgcagtac atgggcctgg aggagaaggt cgcctgcggt       660
     gacgccgacg cgaacatgga gatcctctcc gtcgagaaca gcacggcggg agagtccgcg       720
     tgcgactacg accaggagtt ccagtacatc gtctacaacg agcccgcccc tggccggacg       780
     atctgcatga agcaggtctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page