(data stored in ACNUC1104 zone)

EMBL: AM420293.PE547

AM420293.PE547       Location/Qualifiers
FT   CDS_pept        complement(612263..613282)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0556"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems-like protein"
FT                   /function="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99902"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A4F778"
FT                   /protein_id="CAL99902.1"
FT                   /translation="MSPFPGGGIPRRNLLKLAGGVVTAGALMGTSGCGLLGGSENAGQS
FT                   GPGGLEKANLKVGALATSEIAPLHLAVKNGHFQREGLNVEIVTAKDGASALNAAIGGDY
FT                   DITFSSYVPIFAAQASGVAQLKIVADCASATPNTIMIMTAPGSPVRTAADLAGKKIAIS
FT                   GMGTISQLMVQATMRAHGVDFSRVEWAPIGFPNMPEQLRQGHVDAAFLVEPFLTLAARD
FT                   TKAVPVVDAATGPLQDIPLGGYVSTANFADQNPNTVAAFHRAMQAATDEAQDRSKIEPL
FT                   LPTFAKVDAETAAVMGLLNMHTRVDATRLERVPRLMREFGYIQKDVDVKAMIATPPQN"
     atgagcccgt tccccggtgg agggatccca cgcagaaacc tactgaagct ggcaggcggc        60
     gtggtgacgg ccggtgcact gatgggcacc agcggttgcg ggctcctcgg cggctccgag       120
     aacgccgggc agagcggccc cggcggactg gagaaggcca acctcaaggt cggcgcgctg       180
     gcgacgagcg agatcgcgcc cctgcacctg gccgtcaaga acggccactt ccagcgcgag       240
     ggcctcaacg tcgagatcgt caccgccaag gacggtgcct ccgcgctcaa cgccgccatc       300
     ggcggcgact acgacatcac cttcagctcc tacgtgccga tcttcgccgc ccaggccagc       360
     ggcgtcgccc agctcaagat cgtcgccgac tgcgcgtcgg ccaccccgaa cacgatcatg       420
     atcatgacgg ctccgggttc gccggtgcgc accgccgccg acctcgcggg caagaagatc       480
     gcgatcagcg gcatgggcac catctcccag ctgatggtgc aggcaacgat gcgcgcgcac       540
     ggcgtggact tcagccgggt cgagtgggct ccgatcgggt tccccaacat gcccgagcag       600
     cttcgccagg gccacgtcga cgcggcgttc ctcgtcgagc cgttcctcac gctcgccgcg       660
     cgcgacacca aggccgtgcc ggtcgtcgac gccgccaccg gtccgctgca ggacatcccg       720
     ctcggcggct acgtctccac cgcgaacttc gccgaccaga accccaacac cgtcgcggcg       780
     ttccaccgcg ccatgcaggc ggcgaccgac gaggcgcagg accgcagcaa gatcgagccg       840
     ctgctgccga cgttcgccaa ggtcgacgcc gagaccgccg cggtgatggg cctgctcaac       900
     atgcacaccc gcgtcgacgc cacccgcctg gagcgcgtgc cgcggctgat gcgcgagttc       960
     ggctacatcc agaaggacgt cgacgtcaag gccatgatcg ccaccccgcc ccagaactga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page