(data stored in ACNUC1104 zone)

EMBL: AM420293.PE552

AM420293.PE552       Location/Qualifiers
FT   CDS_pept        complement(619555..621804)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99907"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:A4F783"
FT                   /protein_id="CAL99907.1"
FT                   /translation="MPALADWLRERSDDDLVALLRMRPDLATPPPADSSVLATRAGVRS
FT                   SVARACEDLDAFALSTLEALVLLDADVEAASLGAAAELLGVDVTPQRTRRTLDDLRSRA
FT                   LVWGDDDALSISPAVREALPTFPAGLGRPAENLTEAQAKAAIAELDEDERRLIGKLADG
FT                   SPIGRTRDAAAQTPLERAVNPVQRLLAKGLLLRRDAETVELPRQLAFAVRGDHPMGRVE
FT                   PEEPLLDLTDAGASAVDSTAAGEVLELLRHVELLLDLWGQDPPDVLKSGGVGVRDLRRA
FT                   GKAMEVDETRLGLIAELVVAAGLVANSEEAEPRWIPTYQSDSWLASMPETRWAALAQSW
FT                   LDLPRLPGLIGARDEKDRLLGPLSEDLRRPLAPKDRRRVLDVLDELPSGHGVRGADDLA
FT                   AVLAWRAPRKGGRLRDDLVRWTLAEAAVLGITAMGALSTAGRVLLTDGGAEAARHVALP
FT                   EALDHVLVQADLTVVAPGRLEPDLAAEMKLVADVESAGSATVYRVGESSVRRALDAGRT
FT                   ADDLHALFRNRSRTPIPQSLTYLIDDVARRHGQLRAGTASAFLRCDDPVLLAEVLANPA
FT                   VHELELRKIAPTVLVSPLPLADVVDGLRGAGFSPAAEGPDGQVLDLRASGERVRGRNRP
FT                   NPPAAMSAPSDAQLVELVGQVRAGDRAGAARRGSAVSPERGRPSAEATLQLLRDAARER
FT                   RSVWLGFVDSHGVATQRIVRPVRVGGGVLQGLDQSGDSTGTFPLHRITSVALVEE"
     atgcctgcac tcgccgactg gctgcgcgaa cgcagcgacg acgacctcgt cgcactgctg        60
     cgcatgcggc ccgacctggc cacgcccccg cccgcggaca gcagcgtgct ggccacccgc       120
     gccggggtcc ggtcctcggt ggcccgggcc tgcgaggacc tcgacgcgtt cgccctgtcg       180
     accctggaag cgctcgtcct gctcgacgcc gacgtggagg cggcctccct gggcgccgcc       240
     gccgaactgc tcggcgtcga cgtcaccccg cagcgcaccc gccgcacgct cgacgacctc       300
     cgctcccgcg ccctggtctg gggcgacgac gacgcgctgt cgatctcccc cgcggtgcgc       360
     gaggcgctgc cgacgttccc cgccgggctc ggccgtcccg ccgagaacct caccgaggcg       420
     caggccaaag ccgcgatcgc cgaactcgac gaggacgaac gcaggctgat cggcaagctc       480
     gccgatggct cccccatcgg ccgcacccgg gacgccgccg cgcagacacc gctggaacgc       540
     gcggtcaacc cggtgcagcg gctgctggcc aagggcctgc tgctgcgtcg cgacgccgag       600
     accgtcgagc tgccgcgcca gctcgcgttc gccgtgcgcg gcgaccaccc gatgggccgg       660
     gtggaaccgg aggaaccgct gctggacctg accgacgccg gggcctccgc ggtggactcc       720
     acggcggcgg gcgaggtgct ggaactgctg cgccacgtcg agctgctcct cgacctctgg       780
     ggccaggacc cgccagacgt gctgaagtcc ggcggtgtcg gggtccgcga cctgcgtcgc       840
     gcgggcaagg cgatggaggt cgacgagacc aggctggggc tgatcgccga actcgtggtc       900
     gcggccgggc tcgtcgccaa cagcgaggag gccgagccgc gctggatccc gacctaccag       960
     tccgacagct ggctcgcctc gatgcccgag acccgctggg cggcgctcgc ccagtcgtgg      1020
     ctcgacctgc cccggctccc cggcctgatc ggcgcccgcg acgagaagga ccggctgctc      1080
     gggccgctgt cggaggacct gcgccggccg ctggccccga aggaccggcg ccgcgtcctc      1140
     gacgtcctcg acgagttgcc gtccgggcac ggagtccgcg gcgccgacga cctggccgcg      1200
     gtgctcgcgt ggcgtgcgcc gcgcaagggc ggacggctgc gcgacgacct ggtgcgctgg      1260
     acgctggcgg aggcggcggt gctcggcatc accgccatgg gcgcgctctc caccgccggc      1320
     cgggtcctgc tgaccgacgg aggcgcggag gccgccaggc acgtggcttt gccggaggcg      1380
     ctcgaccacg tgctggtcca ggccgacctg accgtggtcg cccccggcag gctcgaaccg      1440
     gacctggccg ccgagatgaa gctggtcgcc gacgtcgagt cggcgggcag cgccaccgtc      1500
     taccgggttg gcgagagcag cgtccggcgt gccctggacg ccggacggac ggccgacgac      1560
     ctgcacgcgc tcttccggaa ccgctcgcgc acgccgattc cgcagtcgct cacctacctg      1620
     atcgacgacg tcgcgcgccg gcacggacag ctgcgcgccg gaaccgcgtc ggccttcctg      1680
     cgctgcgacg atccggtgct gctggcggag gtcctggcga acccggccgt gcacgaactg      1740
     gagctgcgca agatcgcccc caccgtgctg gtcagccccc tgccgctggc cgacgtcgtc      1800
     gacgggctgc gcggtgccgg gttctcgccg gcggccgaag gcccggacgg gcaggtcctc      1860
     gacctgcggg cgagcggaga acgcgtgcgc gggcgcaacc gcccgaaccc gcccgcggcg      1920
     atgtcggcac ccagcgacgc gcagctcgtc gaactggtcg gccaggtgcg ggcgggcgac      1980
     cgcgcggggg cggcgcggcg cggcagcgcc gtgagccccg agcgcgggag acccagcgcc      2040
     gaggcgacgc tgcagctgct gcgcgacgcg gcgcgggagc gccgcagcgt gtggctgggc      2100
     ttcgtcgact cgcacggcgt ggcgacgcag cggatcgtgc ggccggtgcg ggtcggcggc      2160
     ggcgtgctcc agggcctgga ccagagcggc gactcgacgg gcaccttccc cctgcaccgc      2220
     atcacgtcgg tggccctggt cgaggagtga                                       2250
//

If you have problems or comments...

PBIL Back to PBIL home page