(data stored in SCRATCH zone)

EMBL: AM420293.PE553

AM420293.PE553       Location/Qualifiers
FT   CDS_pept        622081..622266
FT                   /transl_table=11
FT                   /locus_tag="SACE_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99908"
FT                   /db_xref="UniProtKB/TrEMBL:A4F784"
FT                   /protein_id="CAL99908.1"
FT                   /translation="MAGKTKKDRIDPSWPKVGDGEHPVSEFLADKQGALSPFGDTSFPL
FT                   STETVPYTHPVTKINK"
     gtggccggaa agaccaagaa ggaccgcatc gacccgtcgt ggccgaaggt cggtgacggg        60
     gagcaccccg tgagcgagtt cctcgccgac aagcagggcg cgctgtcccc gttcggcgac       120
     accagcttcc cgctgtcgac cgagaccgtc ccctacaccc acccggtcac caagatcaac       180
     aagtag                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page