(data stored in ACNUC1104 zone)

EMBL: AM420293.PE554

AM420293.PE554       Location/Qualifiers
FT   CDS_pept        622482..623936
FT                   /transl_table=11
FT                   /locus_tag="SACE_0563"
FT                   /product="malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /function="Malic enzyme"
FT                   /EC_number="1.1.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99909"
FT                   /db_xref="GOA:A4F785"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A4F785"
FT                   /protein_id="CAL99909.1"
FT                   /translation="MPVPGPGYSITVRVEAPPSASAAGDLTGSVGRAGGVITAFDVVES
FT                   HADRIVVDITCNALSADHANDITDGLRELPGVTVRKVSDRTFLVHLGGKIEVNSRVALT
FT                   NRDDLSRAYTPGVARVCTAIAENPEDARRLTIKRNSVAVVTDGSAVLGLGNIGPEAALP
FT                   VMEGKAALFKKFAGVNAWPVCLDTQDTEEIIRAVELIAPVYGGINLEDIAAPRCFEIER
FT                   RLREKLNIPVFHDDQHGTAVVVLGALRNALRVVGKDLADCRVVVCGVGAAGSAIIRLLQ
FT                   KKGPADVIAVDIDGIVHTGRGDSDPNLQSIAANTNAEGRTGTLSDAVAGADVFIGVSAP
FT                   NLLNAEEVATMNSDAIVFALANPDPEIDPLEAQKHAKVVATGRSDYPNQINNVLAFPGV
FT                   FRGLLDAHAHEITDDMMIAASNAIADVVDGERLNASFIVPSVFDSAVAPAVADAVRKAA
FT                   TAGRTARPAPVGGSSLPWSMAEDLEY"
     atgccggttc caggtccggg ttattcgatc accgtccgcg tcgaggctcc gccgtccgcg        60
     agcgccgccg gtgacctgac cggttcagtc ggccgcgcgg gcggtgtcat caccgccttc       120
     gacgtcgtcg agtcccacgc cgaccggatc gtcgtggaca tcacgtgcaa cgcgctgtcg       180
     gccgaccacg ccaacgacat caccgacggc ctgcgggagc tgcccggcgt caccgtccgc       240
     aaggtctcgg accggacgtt cctggtgcac ctcggcggca agatcgaggt caactcccgc       300
     gtcgcgctga ccaaccgcga cgacctctcc cgcgcctaca cgcccggcgt cgcccgcgtg       360
     tgcacggcga tcgccgagaa ccccgaggac gcccgccgcc tgacgatcaa acggaactcg       420
     gtcgcggtcg tcaccgacgg ctcggccgtg ctcggtctcg gcaacatcgg cccggaggcc       480
     gcgctgccgg tgatggaggg caaggcggcg ctgttcaaga agttcgccgg ggtcaacgcc       540
     tggccggtgt gcctggacac ccaggacacc gaggagatca tccgcgccgt cgagctcatc       600
     gcccccgtct acggcggcat caacctcgag gacatcgccg cgccgcgctg cttcgagatc       660
     gagcgcaggc tgcgcgagaa gctcaacatc ccggtgttcc acgacgacca gcacggcacc       720
     gcggtcgtcg tgctcggtgc gctgcgcaac gccctgcggg tggtcggcaa ggacctggcg       780
     gactgccgcg tcgtggtctg cggggtcggc gccgccggct cggcgatcat ccggctgctg       840
     cagaagaagg gcccggccga cgtcatcgcc gtcgacatcg acggcatcgt gcacaccggt       900
     cgcggcgact ccgacccgaa cctgcagtcc atcgcggcca acaccaacgc cgagggccgc       960
     accggcacgc tgtccgacgc ggtcgccggt gccgacgtgt tcatcggcgt ctccgcgccg      1020
     aacctgctca acgccgagga ggtggccacc atgaactcgg acgcgatcgt gttcgcgctg      1080
     gccaacccgg acccggagat cgacccgctg gaggcgcaga agcacgccaa ggtggtggcc      1140
     accggtcgca gcgactaccc gaaccagatc aacaacgtgc tggcgttccc gggtgtcttc      1200
     cgcggtctgc tcgacgccca cgcgcacgag atcaccgacg acatgatgat cgcggcgtcc      1260
     aacgcgatcg ccgacgtcgt cgacggcgag cggctcaacg cctcgttcat cgtccccagc      1320
     gtgttcgact cggcggtcgc cccggcggtg gccgacgcgg tgcgcaaggc ggcgacggcc      1380
     ggccggacgg ccaggcccgc gccggtcggc ggttcgtcgc tgccgtggtc catggccgag      1440
     gacctggagt actga                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page