(data stored in ACNUC1104 zone)

EMBL: AM420293.PE556

AM420293.PE556       Location/Qualifiers
FT   CDS_pept        624558..625661
FT                   /transl_table=11
FT                   /locus_tag="SACE_0565"
FT                   /product="putative bifunctional molybdopterim biosynthesis
FT                   protein"
FT                   /function="Molybdopterin biosynthesis enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99911"
FT                   /db_xref="GOA:A4F787"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A4F787"
FT                   /protein_id="CAL99911.1"
FT                   /translation="MTRTARVVAASNRAAAGVYEDRTGPVIVEWLRARGYESPDPAVVP
FT                   DGEPVGAELRRAVADGVDVVITTGGTGISPTDRTPEVTAEVLDYPIPGLAEALRSAGLP
FT                   QVPTAVLSRGLAGVSGRTLIVNLPGSRGGVSDGLGVLEGVLDHAVDQIHGGDHKPHGGA
FT                   AASHGAVTSHGAVASHGGVASHGVGEPHGGIGEPHVGSVAADGSSGGAVAAGQDLGRAA
FT                   PARTQASVLRADVVDEAIDVDELSRLVEHRAAGAVVTFGGVVRDHDGGRGVRELEYTGH
FT                   PSAGDVVAEVAREIAARFEGVRAIAVAHRIGLLAIGDVALGCAVAAEHRKQAFDACSEL
FT                   VDEVKRRLPIWKRQVFDDGSEEWVNCP"
     atgacgcgca cagctcgcgt ggtcgcggcg tcgaaccggg ccgccgccgg tgtctacgag        60
     gaccggaccg ggccggtgat cgtggaatgg ctgcgggccc gcggctacga gtcacctgac       120
     cccgcggtcg tcccggacgg cgagccggtg ggcgcggagc tgcgccgcgc ggtcgccgac       180
     ggcgtcgacg tcgtgatcac caccggcggc accggcatca gcccgaccga ccggacgccg       240
     gaggtcaccg ccgaggtgct cgactacccg atcccgggcc tggccgaggc gttgcgctcg       300
     gcggggctgc cgcaggtgcc gacggcggtg ctgtcgcgcg gtctggccgg ggtcagcggt       360
     cggacgctga tcgtgaacct gcccggttcg cggggcggcg tcagcgacgg gctcggtgtc       420
     ctggagggcg tgctcgacca cgcggtggac cagatccacg gcggggacca caagccgcac       480
     ggcggggcgg ccgcctccca cggcgccgtc acgtcgcatg gcgctgttgc gtcgcatggg       540
     ggcgtcgcgt cgcacggcgt tggcgagcct cacggtggca tcggggagcc gcacgtcggc       600
     tctgtcgcgg ctgacggctc ctccggcggc gcggtcgccg ccggccaaga cctcgggcgc       660
     gcagcgcccg ctcgcaccca ggcgtccgtc ctccgcgcgg acgtcgtcga cgaggcgatc       720
     gacgtcgacg agctctcgcg gctcgtcgag caccgcgccg cgggcgccgt cgtgaccttc       780
     ggtggagtgg tccgcgacca cgacggaggc cgcggcgtcc gggagctgga gtacaccggc       840
     caccccagcg cgggcgacgt ggtcgccgag gtcgcgcgcg agatcgccgc ccgcttcgag       900
     ggcgtgcgcg ccatcgccgt cgcccaccgc atcggcctgc tcgccatcgg cgacgtggcc       960
     ctgggctgtg cggtcgccgc cgaacaccgc aagcaggcct tcgacgcgtg ctcggaactc      1020
     gtcgacgagg tcaagcgccg cctcccgatc tggaagcgcc aggtcttcga cgacggctcc      1080
     gaggaatggg tcaactgccc ctga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page