(data stored in SCRATCH zone)

EMBL: AM420293.PE557

AM420293.PE557       Location/Qualifiers
FT   CDS_pept        complement(626428..627033)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0567"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99912"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A4F788"
FT                   /protein_id="CAL99912.1"
FT                   /translation="MARYHGKHRKPSNAARAAARVAVAGAVIATPLAIAAPANAADWDA
FT                   LAQCESSGNWSANTGNGFSGGLQFTPSTWAAYGGTQYASNAKDATREEQIAVAEKVLAS
FT                   QGKNAWPGCSAKLNWSGGSTKTTKKVTKTETKTQTRTQTKTTSPVQTGGGDYTVQLGDT
FT                   LGKIGEKFGVDYKKIAERNSDIIKDPNLIFPGQKLDIK"
     atggctcgtt accacggcaa gcaccgcaaa ccctccaatg ccgctcgtgc cgcggctcgc        60
     gtcgccgtcg ccggtgccgt gatcgccacc ccgctcgcga tcgccgcccc cgccaacgcc       120
     gccgactggg acgccctcgc gcagtgcgag agcagcggca actggagcgc caacaccggc       180
     aacggcttct ccggcggcct ccagttcacc ccctcgacct gggctgccta cggcggtacc       240
     cagtacgcga gcaacgccaa ggacgccacc cgcgaggagc agatcgccgt cgcggagaag       300
     gtcctcgcgt cgcagggcaa gaacgcgtgg ccgggttgca gcgccaagct gaactggagc       360
     ggtggtagca ccaagaccac caagaaggtc accaagaccg agaccaagac ccagacccgc       420
     acccagacca agaccaccag cccggtgcag accggcggcg gcgactacac ggtgcagctg       480
     ggcgacacgc tcggcaagat cggcgagaag ttcggcgtcg actacaagaa gatcgccgag       540
     cgcaacagcg acatcatcaa ggacccgaac ctgatcttcc cgggccagaa gctcgacatc       600
     aagtga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page