(data stored in ACNUC1104 zone)

EMBL: AM420293.PE563

AM420293.PE563       Location/Qualifiers
FT   CDS_pept        632079..633239
FT                   /transl_table=11
FT                   /locus_tag="SACE_0573"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC-type sulfate/molybdate transport
FT                   systems,ATPase component"
FT                   /EC_number="3.6.3.29"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99918"
FT                   /db_xref="GOA:A4F794"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F794"
FT                   /protein_id="CAL99918.1"
FT                   /translation="MSLRADIEVRRDEFALGAELTVAPGRVLAVLGPNGAGKSTLLSAL
FT                   SGLLTPDRGRIELGGHVWLDTERRVRVPTHRRGVGLLAQNALLFPYLTALENVAFGPRA
FT                   SGLGKAEARRTAAHWLSEVDAAELADRKPGQLSGGQAQRVALARALAADPKLLLLDEPL
FT                   AALDIDAAPAMRGLLHRVLRRQQRPTVLVTHDVLDAVVLADELVVLLDGRIVEAGPTRQ
FT                   VLSRPREAFTARIAGLNLLPGVAADGGLELVGGTTASVAMEPGSGAAGGAEGQDGAAVA
FT                   LHGRVAEPLEAGEPAAAVFAPSAVAVHRDRPHGSPRNTIPVRLTGLEPRGDVVRVRGAV
FT                   RDCPLAADVTPAAVADLSLVPGDEVWFVVKAAEVAIHPVSGGSSGA"
     atgagcctgc gggccgacat cgaggtgcgg cgcgacgagt tcgcgctggg cgcggagctg        60
     accgtcgcgc cgggccgggt cctggcggtg ctcgggccga acggggcggg caagtcgacg       120
     ctgctgtcgg cgttgtccgg cctgctcacg cccgaccggg gacgcatcga gctgggcggg       180
     cacgtgtggc tcgacaccga gcggcgggtc cgggtgccga cacaccgcag gggtgtcggg       240
     ctcctcgcgc agaacgcact gctcttcccc tacctgacgg ccctggagaa cgtcgcgttc       300
     ggaccccgtg cgtccgggct cggcaaggcc gaggcccggc ggacggccgc gcactggctg       360
     tccgaagtgg acgccgcgga gctggccgac cgcaagcccg ggcagctctc gggaggtcag       420
     gcgcagcggg tcgcgctggc gcgggccttg gcggcggacc cgaagctgct gctgctcgac       480
     gagccgctgg ccgcgctcga catcgacgcc gcgcccgcga tgcgaggact gctgcaccgc       540
     gtgctgcgcc ggcagcagcg cccgaccgtg ctggtcaccc acgacgtcct cgacgccgtg       600
     gtgctggcag acgaactggt cgtgctgctc gacgggcgga tcgtcgaggc ggggccgacc       660
     aggcaggtgc tctcccggcc gagggaggcg ttcaccgcgc gcatcgccgg gctcaacctg       720
     ctgcccggcg tcgccgcgga cggcgggctc gagctggtgg gcggcacgac ggcgagcgtg       780
     gcaatggagc caggcagcgg agcggccggc ggggccgaag gccaggacgg cgccgccgtc       840
     gcgctccacg gccgggtcgc cgagccgctg gaagccggcg aacccgccgc ggcggtgttc       900
     gcgccgtcgg cggtcgcggt gcatcgggat cgcccgcacg gcagcccgcg caacacgatc       960
     ccggtccgcc tcaccggtct cgaaccgcgc ggtgacgtgg tgcgggtgcg aggcgcggtg      1020
     cgggactgcc cgctggccgc cgacgtcacg cccgccgccg tcgccgacct gtcgctggtc      1080
     ccgggtgacg aggtctggtt cgtggtcaag gccgcagagg tggcaatcca ccccgtctcc      1140
     ggaggatcat ctggggcgtg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page