(data stored in ACNUC1104 zone)

EMBL: AM420293.PE565

AM420293.PE565       Location/Qualifiers
FT   CDS_pept        complement(634040..634378)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99920"
FT                   /db_xref="UniProtKB/TrEMBL:A4F796"
FT                   /protein_id="CAL99920.1"
FT                   /translation="MITDLELERVAAVIERVLRRRDGTATWEQVERLRLQSDLLDRLAA
FT                   AQRHWGGSIGGRAEMVRDAAERLADELNRAPGATTEHECPCCAERAAAAGRRPGGDDVR
FT                   AAKTSPPA"
     atgatcaccg acctcgaact ggagcgggtg gcggcggtca tcgaacgggt gttgcggcgc        60
     cgcgacggca ctgcgacctg ggaacaggtc gaacggctgc ggttgcagtc ggacctgctc       120
     gaccggctcg ccgccgcgca gcggcactgg ggcggctcga tcggcggtcg cgccgaaatg       180
     gtgcgcgacg ccgccgagcg gctcgccgac gagctcaacc gggcaccggg cgcgacgaca       240
     gagcacgagt gcccctgctg cgccgaacgc gccgcggccg ccggccggcg gccgggcggt       300
     gacgacgtcc gcgccgcgaa gacgtcaccc ccggcctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page