(data stored in SCRATCH zone)

EMBL: AM420293.PE569

AM420293.PE569       Location/Qualifiers
FT   CDS_pept        637775..638020
FT                   /transl_table=11
FT                   /locus_tag="SACE_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99924"
FT                   /db_xref="GOA:A4F7A0"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A0"
FT                   /protein_id="CAL99924.1"
FT                   /translation="MAREYDAQLLESVAVRRGRLRESLLWGRARRQMATVDNLKRLAIS
FT                   VVVAAVCCAGCVGWSFLENALAQQKRQQTTSSQVVR"
     gtggcacgag agtacgacgc gcagctcctc gagtcggtgg ccgtccggcg cgggcggttg        60
     cgcgaatcgt tgctgtgggg ccgagcccgc cgccagatgg cgaccgtcga caacctcaag       120
     cgcctcgcga tcagcgtcgt ggtcgcggcc gtgtgctgcg cgggctgcgt cggctggtcg       180
     ttcctggaga acgcgctggc gcagcagaag cgccagcaga ccacgagcag ccaggtggtg       240
     cgatga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page