(data stored in ACNUC1104 zone)

EMBL: AM420293.PE572

AM420293.PE572       Location/Qualifiers
FT   CDS_pept        640949..644755
FT                   /transl_table=11
FT                   /locus_tag="SACE_0582"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /function="DNA segregation ATPase FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99927"
FT                   /db_xref="GOA:A4F7A3"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A3"
FT                   /protein_id="CAL99927.1"
FT                   /translation="MQGLLPMAGAAASMTMMMFFRGSGFAALGAVVMLVSVCAAALFYF
FT                   TQRGQATRKRRQQRERYLDHLEQLRDDLRDWEQDFQRRASVPDPPVGRLLDLVHDPARL
FT                   WERRRGDTDFLLVRVGTGHQPVRELRMRVEGTPVNPPDSFMLAEANALRRRFGTVPHLP
FT                   LRVNLDRAGDVSLIGEGRDAVLGAARTLIAQVAAMHAPDDVMIAVITPPEREADWAWVR
FT                   WLPHALGRAHIGPGGPQPLFAPDAAALAALLADDLTDRATRAAQAFRHGSGAAEAVTRS
FT                   RLLVIDDAFGDVARKLPTPDKGVGLDRLGVTVLHLLSNRLHEPSEISSRVTVGEQVTVE
FT                   QTEPRAMRAGTLEPASHAFAAGLARELAPLRLSADSYDDGSGTPPADFLQLLGMEDPAK
FT                   LDVDRMWAQRGERDFLRVPIGVTALGNATLLDLKESAQLGMGPHGLCVGATGSGKSELL
FT                   RTLVLALVAAHSPRQLSLVLVDYKGGATFAPFEKLPHTAGLITNLESDSSLVERMYASL
FT                   DGEVQRRQQLLADADKSVDITQYAMRRAALGEPEELPPLQHLFVVIDEFGELMTAKPEF
FT                   IELFLRIGRIGRSIGVHLLLSSQRIEGGKLRGLETYLSYRLGLRTLSEMESRTVLDTPD
FT                   AFHLPPLPGAGYLKVDTSVYDQFKSAYVSGPVAEPEEARPVETGAPRVLAMPRYGSPDE
FT                   QEQTDHPKATRRTIGPTLLSTIVEQLEGAAEPVAPVWLEPLPSAVTLDQAAGGFDVTVD
FT                   GLRLRDTGAAGLPVPMGRLDDPARQWQGTWTLDLSSAGGNLLVLGGPGAGKTTALRTLA
FT                   LGLACAHRPTDIGIYGIDLLGSGMRALADLPHVGGVAGRDDRERIRRTVDELHGMLSER
FT                   ERLFQRRQVDDIAQLRGKPAELPCTEVVLLIDGYGQLAGEFEAIESRVHDLLARGGRYG
FT                   IHVVATARRWNEVRGAQQVGFGNRIELRLTDPAESSIDGKLARAVGAKQLGRALTTDKL
FT                   FAQVALPRLDSVPDPAGSGLPEAAALVRSTWTGPVPPPIRVLPAVLDPRELPATDRGTV
FT                   ALGRFENDFGAANLDLFGRDQHLLVLGDTGTGKTNLLKLVTSTLVRQYPAEEIVFAVFD
FT                   PRHGLEGLVPEDHLGGYASNHALANQLAQAVSQELVKRGSPDHPAGPRIVLVIDDYDVL
FT                   AASGSQPLAPFVPFLASGRDLGLHVVMTRRVMGAARGLFEPFTMGVRESGCLSLLMSGD
FT                   RSEGQLFPGVRPTTLPPGRALHVRPGDQTRTVQTAFLDYLEES"
     gtgcaggggc tcctgccgat ggccggtgcc gcggcgtcga tgacgatgat gatgttcttc        60
     cggggcagcg gcttcgcagc gctcggcgcg gtcgtcatgc tggtgtcggt ctgcgcggcc       120
     gcgctgttct acttcaccca gcgcggtcag gccacccgca agcgccgcca gcagcgcgag       180
     cgctacctcg accacctgga acagctccgc gacgacctgc gggactggga acaggacttc       240
     cagcgccgcg cctcggtgcc ggacccaccg gtcggcagac tgctcgacct ggtgcacgat       300
     ccggcccggt tgtgggagcg gcgccgcggc gacaccgact tcctgctggt gcgcgtcggc       360
     accgggcacc agccggtgcg ggagctgcgg atgcgcgtcg agggcacgcc ggtcaacccg       420
     ccggactcgt tcatgctggc cgaggccaac gccctgcgcc gccggttcgg caccgtcccg       480
     cacctgccgc tgcgggtgaa cctggaccgc gcgggcgacg tctcgctgat cggggagggc       540
     cgcgacgcgg tcctcggcgc cgcccgcacg ctgatcgcgc aggtcgcggc catgcacgca       600
     cccgacgacg tgatgatcgc cgtgatcacc ccgccggagc gggaggcgga ctgggcgtgg       660
     gtgcggtggc tgccgcacgc gctgggccgc gcgcacatcg gccccggcgg cccgcagccg       720
     ctgttcgccc ccgacgccgc ggcgctggcc gcgctgctgg ccgacgacct caccgaccgc       780
     gcgacgcgcg cggcgcaggc gttccgccac ggctcgggtg cggccgaggc ggtgacgcgc       840
     tcgcgactgc tggtgatcga cgacgccttc ggcgacgtgg cgcggaagct gccgacgccg       900
     gacaaggggg tcgggctgga ccggctcggc gtcaccgtgc tgcacctgct gtccaaccgg       960
     ctgcacgagc cgagcgagat ctccagccgg gtgaccgtcg gggagcaggt caccgtcgag      1020
     cagaccgaac cgcgcgcgat gcgcgccggc accctcgaac cggcctcgca cgcgttcgcc      1080
     gccggactgg cccgcgagct cgcgccgctg cgcctgtcgg ccgactccta cgacgacggt      1140
     tcgggcaccc cgcccgcgga cttcctccag ctcctgggca tggaggatcc ggcgaagctc      1200
     gacgtcgatc ggatgtgggc gcagcgcggc gagcgcgact tcctgcgggt gccgatcggc      1260
     gtcaccgcgc tgggcaacgc gaccctgctc gacctgaagg agtccgcgca gctcgggatg      1320
     ggtccgcacg ggttgtgcgt cggcgcgacc gggtcgggca agagcgagct gctgcgcacg      1380
     ctggtgctcg ctctggtggc cgcccactca ccgcggcagc tcagcctcgt gctggtcgac      1440
     tacaagggcg gcgcgacgtt cgcgccgttc gagaagctgc cgcacaccgc gggcctgatc      1500
     accaacctgg agtccgactc ctcgctggtc gagcggatgt acgccagcct cgacggggag      1560
     gtccagcgca ggcagcaact gctggccgac gcggacaaga gcgtggacat cacccagtac      1620
     gcgatgcgcc gggccgccct gggcgagccg gaagaactgc cgccgttgca gcacctgttc      1680
     gtggtgatcg acgagttcgg cgagctgatg acggcgaagc cggagttcat cgagctgttc      1740
     ctgcggatcg gccgcatcgg ccggtcgatc ggtgtgcacc tgctgctgtc gagccagcgg      1800
     atcgagggcg gcaagctccg cgggctggaa acctacctgt cctaccggct ggggctgcgg      1860
     acgctgtcgg agatggagag ccggacggtg ctggacaccc cggacgcctt ccacctgccg      1920
     ccgctgcccg gcgccggcta cctcaaggtc gacaccagcg tgtacgacca gttcaagtcc      1980
     gcctacgtgt cgggtccggt cgccgagccg gaggaagccc gtcccgtcga gaccggggca      2040
     ccgcgagtgc tggccatgcc ccgctacggc tcgccggacg aacaggagca gaccgaccac      2100
     ccgaaggcga cccggcgcac gatcggcccg accttgctgt cgaccatcgt cgagcagttg      2160
     gagggcgctg ccgaacccgt cgcaccggtc tggctggagc cgctgccctc ggcggtcacc      2220
     ctcgaccagg ccgcgggcgg cttcgacgtc acggtggacg gcctgcgcct gcgggacacc      2280
     ggcgcggcgg gcctgccggt gccgatggga cggctggacg acccggcccg gcagtggcag      2340
     ggcacctgga cgctggacct gtcgtcggcg ggcggcaacc tgctggtcct cggcggtccg      2400
     ggtgcgggca agaccaccgc gctgcggacg ctggcgctgg gactggcctg cgcgcaccgc      2460
     cccaccgaca tcggcatcta cggcatcgac ctgctcggca gcggcatgcg cgcgctggcc      2520
     gacctgccgc acgtcggtgg tgtcgcgggc cgcgacgacc gggagcgcat ccggcgcacc      2580
     gtcgacgagc tgcacggcat gctgtccgag cgcgagcggc tgttccagcg caggcaggtc      2640
     gacgacatcg cgcaactgcg cgggaaaccg gccgagctgc cctgcaccga ggtcgtgctg      2700
     ctgatcgacg gctacggcca gctcgcgggc gagttcgagg cgatcgagag ccgcgtgcac      2760
     gacctgctcg cccgcggcgg ccgctacggc atccacgtcg tggccaccgc gcgccggtgg      2820
     aacgaggtgc gcggcgccca gcaggtcggc ttcggcaacc gcatcgagct gcggctgacc      2880
     gacccggcgg agtcgagcat cgacggcaag ctcgcccgcg ccgtcggcgc caagcagctc      2940
     ggcagggcgc tgaccaccga caagctgttc gcccaggtcg cactgccccg gctggactcc      3000
     gtcccggacc cggcgggctc cgggctgccg gaggccgccg cactggtgcg cagcacctgg      3060
     accggaccgg tgccgccgcc gatccgggtg ctgcccgcgg tgctcgaccc gagggagctg      3120
     cccgccaccg accgcggcac cgtcgcgctg ggacgcttcg agaacgactt cggcgcggcg      3180
     aacctcgacc tgttcgggcg cgaccagcac ctgctcgtcc tcggcgacac cggaacgggc      3240
     aagacgaacc tgctgaagct ggtcacctcg acgctggtgc ggcagtaccc ggcggaggag      3300
     atcgtcttcg cggtgttcga cccgcggcac ggcctggaag gtctggtgcc cgaggaccac      3360
     ctcggcggtt acgcgagcaa ccacgcgctg gccaaccagc tcgcgcaggc ggtgtcgcag      3420
     gaactggtca agcgcgggtc accggaccac ccggcggggc ccaggatcgt gctcgtcatc      3480
     gacgactacg acgtcctggc cgcctccggc agccagcctc tcgcgccgtt cgtgcccttc      3540
     ctggcgtcgg gccgggacct cgggctgcac gtcgtcatga cccggcgcgt catgggggcc      3600
     gcgcgcgggc tgttcgagcc gttcaccatg ggtgtcaggg aatcgggctg cctgagcctg      3660
     ctcatgtccg gcgaccgctc ggaggggcag ctcttcccgg gcgtgcgccc gacgacgctg      3720
     ccgccgggac gggccctgca cgtccggccc ggcgaccaga cccgcaccgt gcagaccgca      3780
     ttcctggatt acctggagga gtcgtga                                          3807
//

If you have problems or comments...

PBIL Back to PBIL home page