(data stored in ACNUC1104 zone)

EMBL: AM420293.PE573

AM420293.PE573       Location/Qualifiers
FT   CDS_pept        644799..645149
FT                   /transl_table=11
FT                   /locus_tag="SACE_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99928"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A4"
FT                   /protein_id="CAL99928.1"
FT                   /translation="MTFDIVALCREQPGPGAMLAAMRAAGAELRVNTIDEAQLIQLYHE
FT                   DGRLMMTTEGARLVQVRGEVRRLLGFDEDVPHPVWWVETRAPGGDPEAEAAARRFTQAL
FT                   VTTSGGVSWSTR"
     gtgaccttcg acatcgtggc cctgtgccgc gaacagcccg gcccgggagc gatgctcgcg        60
     gcgatgcgag ccgccggtgc ggaactgcgc gtcaacacca tcgacgaggc gcagctcatc       120
     cagctctacc acgaggacgg gcggctgatg atgaccaccg agggagcgcg gctggtgcag       180
     gtgcgcggcg aggtgcggcg gctgctcggg ttcgacgagg acgtgccgca cccggtgtgg       240
     tgggtggaaa cccgcgcacc cggcggcgac ccggaagccg aggcggcggc ccggcgcttc       300
     acccaggccc ttgtcaccac gtcgggaggt gtgtcgtggt cgacgcgctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page