(data stored in ACNUC1104 zone)

EMBL: AM420293.PE576

AM420293.PE576       Location/Qualifiers
FT   CDS_pept        complement(646557..647102)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99931"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A7"
FT                   /protein_id="CAL99931.1"
FT                   /translation="MHEFLVRHFGEEISHPKLGPIAVRDEVTRDFDIAETFAVDTVRAI
FT                   DSGNPADGLMSGGIVVPKDGSPVHWAPTMPAVEDYVKAVADGERWWSSGGAEPVTEVTY
FT                   YGLLTPGRTRSNPSGVLRRRTAAGNTTDEVFTRNLRWEPTDYFRKYELGHNDDEQVEIT
FT                   PGEAAEFVRRIRSKLAQS"
     ttgcacgagt tcctcgtgcg ccacttcggg gaggagatca gccacccgaa gctggggccg        60
     atcgcggtcc gggacgaggt cacgcgggac ttcgacatcg ccgagacctt cgccgtggac       120
     acggtgcggg ccatcgacag cgggaatccc gctgacgggt tgatgagcgg cgggatcgtc       180
     gttcccaagg acggctcgcc ggtccactgg gcgccgacca tgcccgccgt cgaggactac       240
     gtgaaggcgg tcgccgacgg tgagcgctgg tggtcctccg gcggcgcgga accggtcacc       300
     gaggtcacct attacggatt gctcactccc ggtcgcaccc gcagcaatcc cagcggagtc       360
     ctgcgccgtc gcaccgcggc gggcaacacc accgacgagg tcttcacccg gaacctgcgg       420
     tgggagccga ctgactactt ccgcaagtac gaactcgggc acaacgacga cgagcaagtg       480
     gagatcactc caggtgaggc ggccgagttc gtcaggagga tccgttcgaa gctcgcccag       540
     tcgtag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page