(data stored in ACNUC1104 zone)

EMBL: AM420293.PE577

AM420293.PE577       Location/Qualifiers
FT   CDS_pept        complement(647154..650141)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99932"
FT                   /db_xref="InterPro:IPR028908"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A8"
FT                   /protein_id="CAL99932.1"
FT                   /translation="MINPAEIPQIPGDMDALAGHASTLKTAGAAFASTGADVHAKWQGL
FT                   AAVYDAPEAGQLLNATQPVSAVSDTVGGNVETVAGALSTYATTVKPIKARLESLRAQAQ
FT                   TFVSSVEGDDDWREDEGKVNQHNQLLSQVNEAVAEWMEAQRTCANAINAVYGGTQYAAD
FT                   NGDGRRDPNEFGYTKDQLNSALGEGLPWGKAEEHDGGFWGDVGDFFVGIKDGAVQMVTD
FT                   LGALIGYANGEWSWSTAGAAWKGLGTFALALGTYANPLAIVADQTIGLPGFKRGEMGGT
FT                   LLNAGKSIIAYDQWGKGHNGRAAGQATFNIVSAVVGTKGAGAGLKGAGAAIQGGKVAGM
FT                   AAKVGGGMVRAGDFVAKMPTVGELGIKLANKLNIHIPHLGPTPALAGDGPSFGHRVDTD
FT                   IADTRGPDVARMDNGGPRGGGPSVGDGLHHTPDGHHGGGTPPGGNTATDGPRDSGVPDG
FT                   RQPSDSHVGGSHHGNGHVSGDGTTLHNGDRPIDSRTPFDGHTQVEGHAPVDGHTPDGDR
FT                   PDGDHTSSPDGGDPSSTSPAPGADTPALPERLGNQPDGSWVNVEHGTRYDLSPEMNAAV
FT                   DRYLGGASVTEGHVTPHVRSIADGIDGARLQGYPDFVLKGEDSFKRKFAQDLARYPDLS
FT                   PDEILANVKDSVRYTIEMPSRNYTDGVLSAVDDLRARGYENVTFKPTWENPDTYKGVNS
FT                   TWRDPATGRVFELQFHTPDSFKAKMDTHGLYEAERVATDEADRLRAAEAQAEIFRQVDV
FT                   PDHAIDRLHELKQTLEAERAAVDPADHAPPQHPDADGHGHHDGNPAPGPADPGDPAGHG
FT                   DGAGDAAPDWSAVSGTTDVNSKPALHSGTATPEQAQRYVAEHHPYVVDVNVDRFQRGVP
FT                   GSDQNCSRCVRAVDLGFTGTPASALPWPEGPGWGLSSNTFADYARSLGADPAAFRQVSS
FT                   YDDIIGDMTARGEGARGMVYIGRPGSAHVFNVVHDQNGVVFLDGQTGGLALLEKNVNIM
FT                   YLPIGR"
     gtgatcaacc cggccgagat cccgcagatc cccggcgaca tggacgcgct ggccgggcac        60
     gcgtcgacgc tgaagaccgc cggtgcggcc ttcgcctcca ccggcgccga cgtgcacgcg       120
     aagtggcagg gcctggcggc ggtctacgac gcgccggagg ccggtcagct gctcaacgcc       180
     acgcaaccgg tgtcggcggt cagcgacacc gtcggcggca acgtcgagac cgtcgcgggg       240
     gcgctctcga cctacgcgac gacggtcaag ccgatcaagg ccaggctgga gtcgctgcgg       300
     gcgcaggcgc agaccttcgt gtcctcggtg gagggcgacg acgactggcg cgaggacgag       360
     ggcaaggtca accagcacaa ccagttgctc tcgcaggtca acgaggccgt cgccgagtgg       420
     atggaggccc agcggacctg cgccaacgcg atcaacgcgg tctacggcgg gacgcagtac       480
     gccgccgaca acggcgacgg caggcgcgac cccaacgagt tcggctacac caaggaccag       540
     ctgaactccg ccctcggcga gggcctgccg tggggcaagg cggaggagca cgacggcggt       600
     ttctggggcg acgtcggcga cttcttcgtc ggcatcaagg acggcgccgt gcagatggtc       660
     accgacctcg gtgcgctgat cggctacgcg aacggcgagt ggagctggtc cacagcgggc       720
     gcggcctgga aggggctcgg caccttcgcg ctggcgctcg gcacctacgc caaccccctc       780
     gcgatcgtgg cggaccagac gatcggcctg ccaggtttca agcgcggcga gatgggcggc       840
     acgctgctca acgcgggcaa gtcgatcatc gcctacgacc agtggggcaa gggccacaac       900
     ggacgcgcgg ccgggcaggc gacgttcaac atcgtctccg ccgtggtcgg caccaagggt       960
     gccggcgcgg gcctgaaggg tgccggcgcg gcgatccagg gcggcaaggt cgccgggatg      1020
     gccgccaagg tcggcggcgg catggtgcgg gccggcgact tcgtggcgaa gatgcccacg      1080
     gtcggcgagc tcggcatcaa gctggccaac aagctcaaca tccacatccc ccacctcggc      1140
     ccgaccccgg ccctggccgg cgacggcccg tcgttcgggc accgcgtcga caccgacatc      1200
     gcggacaccc gcggccccga cgtcgcacgc atggacaacg gcggaccccg cggcggcggc      1260
     cccagcgtcg gcgacggcct gcatcacacc ccggacggcc accacggcgg tgggacgccc      1320
     ccgggcggga acaccgcaac ggacggccct cgtgacagcg gtgtcccgga cggccggcaa      1380
     ccgtccgaca gccacgtcgg cggatcgcac cacggcaacg gacacgtatc cggcgacggc      1440
     acgaccctgc acaacggtga ccgcccgatt gatagccgca ctccgttcga cgggcacacc      1500
     caggtcgaag gccacgctcc ggtcgacggc cacactccgg acggcgatcg ccctgatggc      1560
     gaccacacca gttcgccgga cggcggcgac ccgtcgagca ccagcccggc tcccggcgcg      1620
     gacactcctg cgctgcccga acgactcggc aaccagcccg acgggtcgtg ggtcaacgtc      1680
     gagcacggaa cgcggtacga cctgtcgccg gagatgaacg cggcggtgga ccgctacctc      1740
     ggtggcgcca gcgtcaccga agggcacgtc accccgcacg tccggtcgat cgcggacggc      1800
     atcgacggcg ccaggctcca gggttatccg gacttcgtgc tcaagggcga ggactcgttc      1860
     aagcgcaagt tcgcgcagga cctggcgagg taccccgatc tcagcccgga cgagatcctc      1920
     gccaacgtca aggactcggt ccgctacacg atcgagatgc cgtcgcgcaa ctacaccgac      1980
     ggcgtcctga gcgcggtcga cgaccttcgc gcccggggct atgagaacgt caccttcaag      2040
     cccacctggg agaaccccga cacctacaag ggcgtcaact ccacctggcg cgatcccgcg      2100
     acgggacgcg tcttcgagct ccagttccac acgcccgaca gcttcaaggc caagatggac      2160
     acccacggcc tctacgaagc cgaaagggtg gccacggacg aagccgaccg gttgcgggcg      2220
     gccgaggccc aggcggagat cttccgccag gtcgacgttc ccgatcacgc gatcgaccgt      2280
     ctgcacgagc tcaagcagac gctggaggcc gaacgcgcgg cggtggaccc cgccgaccac      2340
     gccccgcccc agcacccgga cgccgacggg catggccatc atgacgggaa tcctgctccc      2400
     ggcccggcgg atccgggcga tcccgcgggg catggcgacg gtgccgggga cgctgctccc      2460
     gactggtccg cggtgtccgg gacgaccgat gtcaacagca agcccgcgct gcattccgga      2520
     accgcgactc ccgagcaggc gcagcgctac gtcgccgagc accacccgta cgtggtcgac      2580
     gtcaacgtgg accgcttcca gcgaggcgtt cccggtagcg atcagaactg cagccgttgc      2640
     gttcgcgccg tcgacctcgg tttcaccgga acgcccgcat cggccctgcc gtggcccgaa      2700
     gggcccggat gggggctgag cagcaacact ttcgccgact acgcccggtc cctcggagcc      2760
     gacccggcgg ctttccgcca ggtgtcgtcc tacgatgaca tcatcggcga catgacggcg      2820
     cggggcgaag gcgctcgcgg catggtctac atcggtcgcc ccggttccgc tcacgtcttc      2880
     aacgtggtcc acgatcagaa cggcgttgtc ttcctggacg ggcagaccgg tggtctggcg      2940
     ctcctggaga agaacgtcaa catcatgtac ttgccgatcg ggagatga                   2988
//

If you have problems or comments...

PBIL Back to PBIL home page