(data stored in SCRATCH zone)

EMBL: AM420293.PE578

AM420293.PE578       Location/Qualifiers
FT   CDS_pept        complement(650138..650485)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99933"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7A9"
FT                   /protein_id="CAL99933.1"
FT                   /translation="MGRWDIQPAGVQGVLQQVEGVADDFEGHLRSINSAMEGAGTQASS
FT                   GIIGQALTGFANSQRSSIEFVFTRTGAAMNGAVNATQAYVRGDLEMAANAQANATAAPD
FT                   PRGTMPNGGAR"
     gtgggccgct gggacatcca gcccgcaggt gtgcagggcg ttttgcagca ggtcgaaggc        60
     gtggccgatg acttcgaggg ccacctgcgt tcgatcaaca gcgcgatgga gggggccggg       120
     acgcaggcgt cgtccgggat catcgggcag gcgctgacgg ggttcgcgaa ctcccagcgg       180
     tccagcatcg agttcgtgtt cacccgcacc ggcgcggcga tgaacggcgc tgtcaacgcc       240
     acccaggcgt acgtgcgcgg tgacctggag atggccgcga acgcgcaggc caacgccacc       300
     gccgcccccg acccgcgcgg caccatgccg aacgggggcg cccggtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page