(data stored in SCRATCH zone)

EMBL: AM420293.PE579

AM420293.PE579       Location/Qualifiers
FT   CDS_pept        complement(650507..650812)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99934"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B0"
FT                   /protein_id="CAL99934.1"
FT                   /translation="MTMDRRSFDTGVSQSVQGDLQGIIGRLESVIGQRDQAVAAAMADF
FT                   QADGVSDDYHHVEQRWKSAATEVRQIINLVKQTMTQNDDSANTALSRARSAVQGIG"
     atgacgatgg accggcgcag cttcgacacc ggcgtctcgc agtcggtgca gggcgacctt        60
     cagggcatca tcgggcggct ggagtcggtg atcggccagc gcgaccaggc ggtcgccgcc       120
     gcgatggccg acttccaggc cgacggggtc tccgacgact accaccacgt cgagcagcga       180
     tggaagtccg cggccaccga ggtgcggcag atcatcaacc tggtcaagca gaccatgacc       240
     cagaacgacg actccgcgaa cacggcgctg tcgcgtgcgc gttcggcggt gcagggcatc       300
     ggctga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page