(data stored in ACNUC1104 zone)

EMBL: AM420293.PE580

AM420293.PE580       Location/Qualifiers
FT   CDS_pept        complement(650832..651164)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99935"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B1"
FT                   /protein_id="CAL99935.1"
FT                   /translation="MKFDMGSSTLSTLTKQTQGSSDDLGALIRQLIAAAEPLQGKFNGA
FT                   GRAAFDGFKTRADEITAELNSSLAAILGGQSGMDSSFGQGDTEMADNATSAQGSANFDA
FT                   ARFGAR"
     gtgaagttcg acatggggtc gtcgacgctg tcgacgttga ccaagcagac ccagggttcc        60
     agcgacgacc tgggcgcgct tatccggcag ttgatcgccg cggcggagcc gctgcagggc       120
     aagttcaacg gtgccggccg agcggccttc gacgggttca agacccgcgc cgacgagatc       180
     accgccgagc tcaacagctc gcttgcggcg atcctgggcg gccagtccgg gatggactcc       240
     tcgttcggcc agggcgacac cgagatggcc gacaacgcca cctcggcgca gggttcggcc       300
     aacttcgacg cggcccgctt cggtgcccgc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page