(data stored in ACNUC1104 zone)

EMBL: AM420293.PE581

AM420293.PE581       Location/Qualifiers
FT   CDS_pept        complement(651603..652556)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0591"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /function="Ribonucleotide reductase, beta subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99936"
FT                   /db_xref="GOA:A4F7B2"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F7B2"
FT                   /protein_id="CAL99936.1"
FT                   /translation="MTSTATFREDFHSLRAGGLNWDSLPLRLFGKGNAKFWDPADIDFT
FT                   RDAEDWQGLTEEERRSVAMLCSQFIAGEEAVTQDLQPFMAAMAAEGRFGDEMYLTQFCF
FT                   EEAKHTQVFRLWMDAVGLTGDLHSHVAENPGYRAIFYEELPRSLNALHDDPSPANQVRA
FT                   SVTYNHVVEGTLALTGYFAWQKICRSRGILPGMQEVVRRIGDDERRHMAWGTFTCRRHV
FT                   AADESNWDVVQEQMQHLLPLAVTQIQWRPEDAPEETPFRLDIDELAAYASDRAGRRLGA
FT                   ISAARGVPVEQIDVDASPEQLEDQFGVEDAAALEKA"
     atgacgagca ccgcgacctt ccgcgaagac ttccactccc tgcgggcggg cgggctgaac        60
     tgggactcgc tcccgctccg cctgttcggc aagggcaacg cgaagttctg ggaccccgcc       120
     gacatcgact tcacccggga cgccgaggac tggcagggcc tcaccgagga ggagcggcgc       180
     agcgtggcga tgctctgctc gcagttcatc gccggcgagg aggccgtcac ccaggacctg       240
     cagccgttca tggcggcgat ggcggccgag ggccgcttcg gcgacgagat gtacctgacg       300
     cagttctgct tcgaggaggc caagcacacc caggtgttcc ggctgtggat ggacgccgtc       360
     gggctcaccg gggacctgca ctcccacgtc gccgagaacc ccggctaccg cgcgatcttc       420
     tacgaggagc tgccgaggtc gctcaacgcg ctgcacgacg acccgagccc ggcgaaccag       480
     gtgcgcgcgt cggtcaccta caaccacgtc gtggagggca cgctcgcgct gaccggctac       540
     ttcgcgtggc agaagatctg ccgcagccgg ggcatcctgc cgggcatgca ggaggtcgtg       600
     cgccgcatcg gcgacgacga gcggcgccac atggcgtggg gcaccttcac ctgccggcgc       660
     cacgtcgcgg ccgacgagtc caactgggac gtcgtgcagg agcagatgca gcacctgctc       720
     ccgctggcgg tgacgcagat ccagtggcgg ccggaggacg cgccggagga gacgccgttc       780
     cggctggaca tcgacgagct cgccgcctac gcctcggacc gggccggacg ccgcctcggc       840
     gcgatctcgg ccgcgcgcgg ggtgccggtg gagcagatcg acgtggacgc ctcaccggaa       900
     cagctcgagg accagttcgg cgtcgaggac gccgccgcgc tggaaaaggc ctag             954
//

If you have problems or comments...

PBIL Back to PBIL home page