(data stored in ACNUC1104 zone)

EMBL: AM420293.PE585

AM420293.PE585       Location/Qualifiers
FT   CDS_pept        complement(654398..654874)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99940"
FT                   /db_xref="InterPro:IPR024495"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B6"
FT                   /protein_id="CAL99940.1"
FT                   /translation="MFRGLKPLLLAGTAVALAGCSAPSDPQVTFYSHGQAVEVAPAQYC
FT                   DALGEKCTPPPADPIGELRVPGRAPLQISVPSDVAEAPWQIAFIYRTTSGEEVGGKTEV
FT                   FTGGDRHAYTLQLPGDGVQFEHVEVQRFSALLSPGTEGGVDFVIGGSWIIDVNP"
     gtgttccgag gactgaaacc gctactgctg gcaggcaccg ccgtggcgct cgcgggctgc        60
     tccgcgccca gcgacccgca ggtcaccttc tactcgcacg ggcaggcggt ggaggtcgca       120
     cccgcgcagt actgcgacgc gctgggcgag aagtgcacgc ccccgcccgc cgacccgatc       180
     ggcgagctgc gggtccccgg gcgcgcgccg ctgcagatct cggtgcccag cgacgtggcc       240
     gaggccccgt ggcagatcgc cttcatctac cggacgacct ccggcgagga ggtcggcggc       300
     aagaccgagg tgttcaccgg cggcgaccgc cacgcctaca cgctccagct ccccggcgac       360
     ggcgtgcagt tcgagcacgt cgaggtccag cggttctccg cgctgctcag cccgggcacc       420
     gagggcggcg tggacttcgt catcggcggt agctggatca tcgacgtcaa cccgtga          477
//

If you have problems or comments...

PBIL Back to PBIL home page