(data stored in ACNUC1104 zone)

EMBL: AM420293.PE586

AM420293.PE586       Location/Qualifiers
FT   CDS_pept        complement(654978..656888)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0596"
FT                   /product="hypothetical protein"
FT                   /function="77 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99941"
FT                   /db_xref="GOA:A4F7B7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7B7"
FT                   /protein_id="CAL99941.1"
FT                   /translation="MGGRRDQRPRGRAGWGAGQRGKRGDYDGLSARERDEVSDFSARYA
FT                   RARAEEPPDGRTREPDLGEPIRESDSRGKCENDSRGKSTRGDDRRGKWTRESDSRGKPT
FT                   REGGQRRKWTRRREQHAEADQAQRSEHRFEAPQRRYPWDDDEHRPRYRTSRLPPLPRDH
FT                   HSYRDEPDERADPDDFDGPERPRGTAPPRKLTVTRVAAWRSRDLTQRAMRLFFSAAHAD
FT                   GADRSGLARFTYAVMGNYAVDAAMAVALANTLFFSAATGESKDKVALYLLITVAPFAVI
FT                   APVIGPALDRLQRGRRLALAASFGIRVLLAAVMALNFNSWLLYPAALGCMVLSKSFGVL
FT                   KAAMTPRVLPRAITLTTANSRLTTFGMAAGGVFGAVASGFAWLLGSEGALWFMAAMAAC
FT                   GVWLCLRIPSWVESTEGEVPASISSHPRRAERTPLTGHVVVALWGNGGIRLLTGFLTLF
FT                   AAFVIKQGTQTDPFMQLLLLGMVGGAAGLGSFLGNGAGARMSFGKPDRLIVACLGSALA
FT                   VTVCAALLAGLPMAVVVGLVGATCSALAKVCLDAVIQRDMPEASRASAFGRSETVLQLS
FT                   WVFGGALGVLLPPVYWIGFTVVAVLLALALAQTVVAGRGGSLPARTFWRRGSPEAARTA
FT                   T"
     atgggcggac ggcgtgatca gcggccgcgc ggccgtgcgg gctggggcgc cggccagcgc        60
     ggcaagcggg gcgactacga cgggctgagt gcgcgtgagc gcgatgaggt ctccgacttc       120
     tccgcgcgct acgcgcgcgc acgcgcggag gaaccgcccg acgggcgcac tcgcgaaccc       180
     gacctgggcg agcccattcg cgaaagcgac tcccgcggca agtgcgaaaa cgactcgcgc       240
     gggaagtcca cccgcggaga cgaccggcgc ggcaagtgga cccgcgaaag cgactcgcgc       300
     ggcaagccca cccgcgaagg cggtcagcgc cgcaagtgga cccgccggcg cgaacagcac       360
     gccgaggccg accaggcgca gcgcagcgag caccgcttcg aggcgccgca gcgccgctac       420
     ccgtgggacg acgacgagca ccgcccccgg taccgcacct cccggcttcc cccgctgccc       480
     cgcgaccacc actcgtaccg cgacgagccc gacgagcgcg cggaccccga cgacttcgac       540
     gggccggagc gaccgcgcgg gaccgcgccg ccgcgcaagc tgaccgtcac gcgcgtcgca       600
     gcctggcgca gccgcgacct cacccagcgc gcgatgcgcc tgttcttctc cgccgcgcac       660
     gccgacggcg ccgaccggtc gggcctggcg cgcttcacct acgccgtcat gggcaactac       720
     gccgtcgacg cggcgatggc cgtcgccctg gccaacaccc tgttcttctc cgccgcgacc       780
     ggcgagagca aggacaaggt cgccctgtac ctgctgatca ctgtcgcgcc gttcgcggtg       840
     atcgcgccgg tcatcggccc cgcgctcgac aggttgcagc ggggcaggcg gctggcgctc       900
     gcggcgtcgt tcggcatccg ggtgctgctg gcggccgtca tggcgctgaa cttcaacagc       960
     tggctgctct acccggcggc gctgggctgc atggtgctgt cgaagtcctt cggcgtgctc      1020
     aaggctgcga tgacgccccg ggtgctgccg cgggcgatca cgctgaccac cgcgaactcc      1080
     aggctcacca cgttcggcat ggcagcgggc ggcgtgttcg gcgcggtggc gtcgggcttc      1140
     gcgtggcttc tggggtcgga gggcgcgctg tggttcatgg ccgcgatggc ggcctgcggg      1200
     gtgtggctct gcctgcgcat cccctcctgg gtggagagca ccgagggcga ggtgcccgcc      1260
     tcgatcagct cgcacccgcg ccgcgcggaa cgcaccccgc tgaccggtca cgtcgtcgtc      1320
     gcgctgtggg gcaacggcgg catccggctg ctcaccgggt tcctgacgct gttcgccgcg      1380
     ttcgtgatca agcagggcac ccagaccgat ccgttcatgc agctgttgct gctgggcatg      1440
     gtcggcggcg cggcggggct gggcagcttc ctcggcaacg gtgccggcgc ccggatgtcg      1500
     ttcggcaagc ccgaccggct gatcgtggcc tgcctcggca gcgcgctggc cgtcacggtg      1560
     tgcgcggcgc tgctggccgg gctgccgatg gcggtggtcg tcggcctggt cggcgcgacc      1620
     tgcagcgcgc tggcgaaggt ctgcctggac gcggtgatcc agcgggacat gcccgaggcg      1680
     tcgcgcgcct cggccttcgg ccgctcggag acggtgttgc agctgagctg ggtcttcggc      1740
     ggagcgctcg gggtgctgct gcccccggtg tactggatcg gcttcacggt cgtcgcggtg      1800
     ctgctcgcgc tcgcgctggc ccagaccgtg gtcgccgggc gcggcggctc gctgccggcg      1860
     aggacgttct ggcggcgggg ctctccggag gccgcccgca ccgcgacctg a               1911
//

If you have problems or comments...

PBIL Back to PBIL home page