(data stored in ACNUC1104 zone)

EMBL: AM420293.PE589

AM420293.PE589       Location/Qualifiers
FT   CDS_pept        658754..661708
FT                   /transl_table=11
FT                   /locus_tag="SACE_0599"
FT                   /product="putative heat shock protein, HSP90-family"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99944"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C0"
FT                   /protein_id="CAL99944.1"
FT                   /translation="MNGTDVFGTAELRQAVLQSWRSSPTRFREDANAEEDLRLGGYRDR
FT                   LLVELAQNAADAAGSKGVLRVRLADGELRVANTGEPLTAEGVAGLASLRASAKREGSTV
FT                   GRYGVGFAAVLAVSEEPRVVSSSGSVTFSAERTRQEAERLPGPAEELAARAGEVPVLRL
FT                   VWPLEDVPPEGFATEVRLPLRSGVDADALLESFAEQASGLLLALPALTEIHIGEQTWYR
FT                   TDEGRDRVVVHGPRGAERWQVQRGAGQVGEAALAGLGVEARRDTGWWVCWAAPLDADGV
FT                   PAPLERDVLHAPTPTDERLSLPARLLASVPMEADRRRAAASPATDQVLVRAAECYPELV
FT                   ARIAPEHRPALVPLPGFPMSDVDDKLRQAVTDRLRVAEWLPRAGGGLVAPLEARVLDQA
FT                   LPELAELLRDAVPGLLTAEMAELRHRAALSALEVRRLGPAEIVQAVTGLERPAPWWNRL
FT                   YEALRPIASADSQAREEFAALPVPLADGRTVTGVRDVLLGSDADPAGVLSTLDISGLRI
FT                   VHPEAAHPMLEELGARPAGPDELLDSPSLAEAVRGSVTDAHTSVDARALADAVLGLVER
FT                   SRPRDWLGALALPDSEGGFRRADELLLPEAALREVLAPDAPLGVVDAEFAARWPAGLLR
FT                   SIGVIDSFVVHVEEEPAEPDTGFADAERWWLDNEAEQHDQWPPDRFVGIRDLDLVAEDA
FT                   WPAALRLLAEDPDTLRALRDPAGYPAWWIARHASLAGLPPRHWRLPAAEEIAGLYDPVP
FT                   DVGLDTEQLRLAGVRDAMRVDDAADAADLIERLGDVDRALRAGTALRAHRALADAVACG
FT                   VIDASEIEPPHSVRSLSGAVVSAERAAVLDEPWMLGVLDAPLLVSGGSPDQFDAEALAE
FT                   LFDLPLASEENAMQVQGPGRAQRWGDVARVATSCELLGIAVPTGEVTLHDTLVVQAATT
FT                   GHRVHWWVDTGGTVHAERTPDGLGRALAWAAGSWGERFALGALLADPEATTLLR"
     gtgaacggga ccgacgtctt cggcactgcc gagctgcggc aggcggtgct ccagtcgtgg        60
     cggtcgtcgc ccacgcgctt ccgcgaggac gccaacgccg aggaggacct gcggctgggc       120
     ggctaccgcg accggctgct ggtcgagctg gcccagaacg ccgccgacgc ggccgggtcc       180
     aagggcgtgc tgcgcgtgcg gctggccgac ggcgagctgc gcgtggccaa caccggtgag       240
     ccgctgacgg ccgagggcgt ggcgggcctg gcttcgctgc gcgcgtcggc gaagcgcgag       300
     ggttcgacgg tcggccgcta cggcgtgggt ttcgccgcgg tgctcgccgt ttcggaggaa       360
     ccgcgcgtgg tgtcgtcgtc cggttcggtg acgttctcgg cggaacgcac caggcaggag       420
     gcggagcggc tgcccggccc ggccgaggag ctggccgccc gcgccggcga ggtgccggtc       480
     ctgcggctgg tgtggccgct ggaagacgtg ccgccggagg gtttcgcgac cgaggtcagg       540
     ctgccgctgc gctcgggtgt cgacgcggac gcgttgctgg agtccttcgc cgagcaggct       600
     tccggcctgc tgctcgcgtt gcccgcgctc accgagatcc acatcggcga gcagacctgg       660
     taccgcaccg acgagggccg ggaccgcgtc gtcgtgcacg gcccgcgggg cgccgagcgc       720
     tggcaggtcc aacgcggcgc cgggcaggtc ggtgaggccg cgctggccgg gctcggggtg       780
     gaggccaggc gggacaccgg gtggtgggtc tgctgggccg ctccgctcga cgccgacggc       840
     gtgccggcgc cgctggagcg agacgtgctg cacgccccga ccccgaccga cgagcggctg       900
     tcgctgcccg cgcggctgct cgcgagcgtg ccgatggagg ccgaccggcg ccgcgcggcg       960
     gcatcgcctg ccaccgacca ggtgctggtc cgcgccgccg agtgctaccc ggagctggtc      1020
     gcccggatcg cccccgagca ccggcccgcg ctggtgccgc tgccgggctt cccgatgtcc      1080
     gatgtggacg acaagctgcg gcaggcggtg accgaccggc tgcgggtcgc cgagtggctg      1140
     ccgcgcgccg gcggcgggct ggtcgcgccg ctggaggcgc gggtgctgga ccaggcgctg      1200
     ccggaactgg ccgagctgct gcgcgacgcc gtgccggggc tgctgaccgc cgagatggcc      1260
     gagctgcggc accgcgcggc gctgagcgcg ctggaggtcc ggcggctcgg cccggccgag      1320
     atcgtgcagg ccgtcaccgg cctggaacgc ccggctccgt ggtggaaccg cctgtacgag      1380
     gcgctgcggc cgatcgcgag cgcggacagc caggcgcgcg aggagttcgc cgcgctgccg      1440
     gtcccgctgg ccgacggccg caccgtcacc ggcgtgcgcg acgtgctgct cggctccgac      1500
     gccgacccgg cgggcgtgct gtccacactg gacatatcgg ggctgcgcat cgtgcacccc      1560
     gaggcggcgc acccgatgct ggaggagctg ggcgcgcgcc cggcaggccc ggacgagctg      1620
     ctcgactcgc cgtcgctggc cgaagcggtg cgcggcagcg tcaccgacgc ccacaccagc      1680
     gtcgacgcca gggcgctggc cgacgccgtg ctcggcctgg tcgagcggtc ccgcccccgc      1740
     gactggctcg gcgcgctggc gctgcccgac tccgagggcg gcttccgccg cgccgacgaa      1800
     ctgctgctgc ccgaggccgc cctgcgcgag gtgctggccc cggacgcccc gctcggggtc      1860
     gtggacgccg agttcgccgc ccgctggccc gccggtctgc tgcgctccat cggcgtcatc      1920
     gactcgttcg tcgtgcacgt cgaggaggag cctgccgagc ccgacaccgg tttcgccgac      1980
     gccgagcggt ggtggctcga caacgaggcc gagcagcacg accagtggcc gcccgaccgc      2040
     ttcgtcggca tccgggacct cgacctggtc gccgaggacg cctggcccgc cgcgctccgg      2100
     ctgctggccg aggaccccga caccctgcgc gcgctgcgcg accccgccgg ctacccggcc      2160
     tggtggatcg cccgccacgc gtcgctggcc gggcttccgc cgcgccactg gcggctgccc      2220
     gcagccgagg agatcgccgg tctctacgac ccggttcccg acgtcggcct ggacaccgag      2280
     cagctccgcc tggccggcgt ccgcgacgcg atgcgcgtcg acgacgcggc cgacgccgcg      2340
     gacctgatcg agcgcctcgg cgacgtggac cgcgcgttgc gggcgggtac cgcgcttcgc      2400
     gcgcaccggg cgctggccga cgcggtcgcg tgcggggtca tcgacgcctc ggagatcgag      2460
     ccgccgcact cggtgcggtc gctgtccggc gccgtggtca gcgcggagcg cgcggcggtg      2520
     ctcgacgagc cgtggatgct gggcgtgctc gacgcgccgc tgctggtctc cggcggcagc      2580
     ccggaccagt tcgacgcaga ggcgctggcg gagctgttcg acctgccgct ggcgtcggag      2640
     gagaacgcca tgcaggtcca ggggccgggg cgcgcccagc ggtggggcga cgtcgcgcgc      2700
     gtcgccacgt cgtgcgagct gctgggcatc gcggtgccga ccggcgaggt cacgctgcac      2760
     gacacgctgg tcgtccaggc cgcgaccacc ggccaccggg tgcactggtg ggtggacacc      2820
     gggggcaccg tgcacgccga gcgcacaccg gacggtctcg gccgtgccct ggcgtgggcg      2880
     gcggggagct ggggcgagcg gttcgccctc ggggcgctgc tcgccgaccc ggaagcgacg      2940
     acgctgctgc gctag                                                       2955
//

If you have problems or comments...

PBIL Back to PBIL home page