(data stored in ACNUC1104 zone)

EMBL: AM420293.PE591

AM420293.PE591       Location/Qualifiers
FT   CDS_pept        664266..666092
FT                   /transl_table=11
FT                   /locus_tag="SACE_0601"
FT                   /product="multidrug ABC transporter, ATP-binding protein"
FT                   /function="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99946"
FT                   /db_xref="GOA:A4F7C2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C2"
FT                   /protein_id="CAL99946.1"
FT                   /translation="MEPDAASRPTSSLRTLISRLAPFRGALTVVLLLELGTRAAALIQP
FT                   LAARAVVDGVAARADLMWPIAVLGAVAIIGLCLNYAGFYQRGKLSERFVLGLRKAMAGR
FT                   IVGAPVSYVESRSTADLVSRVGADSTLIQQTTVKALVDLVVVPLTVVAGIVLMLTIDVF
FT                   LALVVIVLLSVAGLAEAGVFRRVVVDTETAQEHVAGLTGVVQRVLLAFRTVKASRSERR
FT                   EAESFDRNADSAYRASVKAVRTGALADTVAYAAVDFTFLVTLAVGVVRVSTGSVGVGDL
FT                   VAILLYVVYIQEPVEALTNSAGKLSEGLAALRRITELLDAPQETDTAAAPARTEVPAVS
FT                   NGSKPPASRRSVRFDQVWFGYGDQPVLRDVSIEAVPGLTVLVGSSGAGKTTLLSLAERF
FT                   VEPERGAVLLDGADVRDLPLAELRGRVAYVQQEAPLLGATIGEAATYGVDDVDEERLRR
FT                   ILESVGLRTWIEGLPLGLDTEVGERGVQISGGQRQRLAVARALARDSEVLLLDEATSQL
FT                   DPLNEQNLVRSLTRDFRDRVVIAVTHRMPMAYQADQVIMLRHGSVHARGTHDDLLSDPH
FT                   YRQLIASPSAGSPELAEQLTASGEDGRGEPGA"
     atggagccgg acgcggcgtc gcgaccgacg tcgtccctca ggaccctcat cagcaggctc        60
     gcgcccttcc ggggcgcgct gaccgtggtc ctcctcctcg agctcggcac ccgcgccgcg       120
     gcgctgatcc agccgctggc cgcacgcgcc gtcgtggacg gcgtcgcggc gcgcgccgac       180
     ctgatgtggc cgatcgcggt gctgggtgcg gtcgccatca tcggcctctg cctgaactac       240
     gcgggcttct accagcgcgg caagctgagc gagcgcttcg tgctggggct gcgcaaggcg       300
     atggccggac ggatcgtcgg cgcacccgtg tcctacgtcg agtcccggtc aaccgccgac       360
     ctggtctcgc gcgtcggcgc cgacagcacc ctgatccagc agacgacggt caaggcgctg       420
     gtggacctgg tcgtcgtgcc gctcaccgtg gtggcgggca tcgtgctgat gctgaccatc       480
     gacgtgttcc tcgcgctggt ggtgatcgtc ctgctctcgg tcgccgggct ggccgaggcc       540
     ggggtgttcc ggcgggttgt cgtcgacacc gaaaccgccc aggagcacgt ggccgggctg       600
     accggcgtgg tgcagcgggt gctgctggcg ttccgcacgg tcaaggcgtc gcgcagcgag       660
     cggcgggagg ccgagtcctt cgaccgcaac gccgactcgg cctaccgggc gagcgtgaag       720
     gccgtccgga cgggggcgct ggccgacacg gtggcctacg ccgccgtcga cttcaccttc       780
     ctggtgacgc tcgcggtcgg cgtggtgcgg gtgagcaccg gcagcgtcgg cgtcggcgac       840
     ctggtggcga tcctgctcta cgtcgtctac atccaggaac cggtggaggc gctgacgaac       900
     tcggcgggca agctctccga gggcctggcc gccctgcggc gcatcaccga gctcctcgac       960
     gcgccgcagg agaccgacac cgcggccgcc ccggccagga ccgaggtccc ggcggtgtcc      1020
     aacggctcca agcccccggc gtcgcggcgg tcggtgcggt tcgaccaggt gtggttcggc      1080
     tacggcgacc agccggtgct gcgcgacgtg tccatcgagg cggtgccggg gctgacggtc      1140
     ctggtcgggt cgtccggcgc ggggaagacc acgctgctca gcctggcgga gcggttcgtg      1200
     gaacccgagc ggggcgcggt cctgctcgac ggagccgacg tccgcgacct cccgctggcg      1260
     gagctgcgcg gccgcgtcgc ctacgtgcag caggaagccc cgctgctcgg cgcgaccatc      1320
     ggggaggccg ccacctacgg cgtggacgac gtcgacgagg agcggttgcg gcgcatcctg      1380
     gagtcggtcg gcctccggac gtggatcgag ggactgccgc tcggactgga caccgaggtc      1440
     ggcgagcgcg gcgtgcagat ctccggcggc cagcgccagc ggctggccgt ggcgcgggcg      1500
     ctggcccgcg acagcgaggt cctgctgctg gacgaggcga cctcgcagct cgacccgctc      1560
     aacgagcaga acctcgtgcg gtcgctcacg cgcgacttcc gcgaccgcgt cgtcatcgcg      1620
     gtcacgcacc ggatgccgat ggcctaccag gccgaccagg tcatcatgct ccgccacggc      1680
     tcggtccacg cccgcggtac gcacgacgac ctgctgtcgg acccgcacta ccggcagctg      1740
     atcgcgtcgc cgtcggccgg ttccccggag ctggcggagc agctgaccgc gtccggggag      1800
     gacgggcggg gtgagcccgg tgcctga                                          1827
//

If you have problems or comments...

PBIL Back to PBIL home page