(data stored in SCRATCH zone)

EMBL: AM420293.PE592

AM420293.PE592       Location/Qualifiers
FT   CDS_pept        666076..666537
FT                   /transl_table=11
FT                   /locus_tag="SACE_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99947"
FT                   /db_xref="GOA:A4F7C3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C3"
FT                   /protein_id="CAL99947.1"
FT                   /translation="MSPVPEDYTWRSPRAGDAGRGESMIRGVAVRDRPTLESTAADFAE
FT                   ALGETDLTSDGFGVFRGEALVGYSLLRSGRDGRWYEVQRCVHGEHRGRGLGTVLLGWGR
FT                   AQAAQRRAVAGTAGELRVWCPDHSAARKSLGELPGRAARVTSEPLLEPR"
     gtgagcccgg tgcctgagga ctacacgtgg cgatcgccgc gagccggcga cgcggggcgc        60
     ggggagtcga tgatccgggg cgtggccgtg cgggaccggc cgaccctgga gagcacggcg       120
     gccgatttcg ccgaagccct cggcgagacc gacctgacga gcgacggctt cggcgtcttc       180
     cgcggcgagg cgctcgtggg ctactcgctt ctgcggtcgg ggcgcgacgg caggtggtac       240
     gaggtccagc gatgcgtgca cggtgagcac cggggccgcg gcctgggaac cgtgctgctc       300
     ggctgggggc gcgcccaggc cgcgcagcgc cgtgcggtgg cgggaaccgc cggcgagttg       360
     cgcgtgtggt gcccggacca cagcgcggcg cggaagtcgc tcggcgaact gcccggcagg       420
     gccgcccggg tgacgagtga gccgctgctg gagccccggt ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page