(data stored in SCRATCH zone)

EMBL: AM420293.PE593

AM420293.PE593       Location/Qualifiers
FT   CDS_pept        666534..669206
FT                   /transl_table=11
FT                   /locus_tag="SACE_0603"
FT                   /product="hypothetical protein"
FT                   /function="Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99948"
FT                   /db_xref="GOA:A4F7C4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C4"
FT                   /protein_id="CAL99948.1"
FT                   /translation="MTGGLLAANSVRPWAELERAACGIAEGLRERGVRTADRVLLCGDN
FT                   SAEYVLVLLALMRLGASIVLTDHRQTPQEARRAADVAQVRWTVADAGVATSAGRRLEIT
FT                   ELVEDRPDAGTAELSLRDWYCLPDGLITWSSGTRGPAKGVVRSGKSFLDNVERSRRRMG
FT                   YRPDDVLMPLLPFSHQYGLSMVLLWWQVRCSLLVAPYRRLDHALELGGRWGATVLDATP
FT                   MTYHSVLNLGAGRPGLLSALRTVRMWCVGGSPLSPALADRFRAATGRPLLDGYGSTETG
FT                   NIALAAPGDETGCGHPLDAVEVLVLDTGGAVAAPGRLGEIAVQSPDLTSGYLEPDGGVR
FT                   PLPPGPHRTGDVGFVDEDGHVFVLGRRGAVHRMGHTLYPDVLAHKAAACGAPVHVLATE
FT                   DERTGCQLVFVVADPRLRAGGYWRRRIQDVLPSYEHPNRVVVVEEMPLNSNGKPDTGQL
FT                   DRLLRGTASGGASSPAVPAQTRRGPTPRNARIPFAERLDALRAVEDFLRNERGAVLDVL
FT                   TEISPLKTAESELASSLATLAGARAEVERHGPRRLSRLAVFMPSNVLCYSYVLYLLVPA
FT                   LYAERIAFRASAQVGAPARRLHELLAPVHGLPVHPHQVSQRRFVDEPVSEADVVVFTGA
FT                   YDNAEQIRSRLRPEQLMLFFGQGVNPFVVASGADLDLAVADAVRIRMLNSGQDCFGPDV
FT                   FLVDAAEADRFVELLVKRLGELRYGDYRDADADYGPLFYDSALQKATEYLRRNHERIVF
FT                   GGRVDLRDRHLHPTVLVRSSSDDLVVEELFSPIFNVVVHHDREQLRAVLRTPFVTDRAM
FT                   AAMVYGDDPETVELLARRHQVCHNRSILDAENGNRPFGGHGIVANYAAHRGRRVAEPLL
FT                   VSKAVADHLSAASDVIGGR"
     gtgaccggcg ggctgctggc ggcgaactcg gtccgcccct gggccgagtt ggagcgcgcc        60
     gcatgcggaa tcgccgaggg gctgcgcgag cgcggggtcc ggacggccga ccgcgtcctg       120
     ctctgcggcg acaactcggc ggagtacgtg ctcgtcctgc tggcgctgat gcggctcggg       180
     gcctcgatcg tgctgaccga ccaccggcag acgccgcagg aggcgcgccg tgccgcggac       240
     gtggcccagg tgcgctggac cgtcgccgac gccggtgtcg cgacctccgc cgggcggcgg       300
     ctggagatca ccgagctcgt cgaggaccgg ccggacgcgg gtaccgcgga gctgtcgctg       360
     cgggactggt actgcctccc ggacggactc atcacgtggt cctcgggcac ccgcggtccg       420
     gccaagggcg tcgtccgctc cgggaagtcc ttcctggaca acgtcgagcg gtcgcggcgg       480
     cggatgggct accgccccga cgacgtgctg atgccgttgc tgccgttctc ccaccagtac       540
     gggctgtcga tggtgctgct gtggtggcag gtccggtgct ccctgctggt ggcgccctac       600
     cggcggctcg accacgcgct ggagctgggc ggccgctggg gggccacggt gctcgacgcg       660
     acgccgatga cctaccacag cgtgctcaac ctcggcgccg gtcgcccggg gctgctgagc       720
     gcgctgcgca ccgtgcggat gtggtgcgtc ggcggttctc cgctcagccc cgcgctggcc       780
     gaccgcttcc gcgccgcgac cggacggccg ctgctggacg gctacggcag caccgagacc       840
     ggcaacatcg ccctggccgc gcccggcgac gagaccgggt gcgggcaccc gctcgacgcg       900
     gtcgaggtcc tggtgctcga caccgggggc gccgtggcgg cgcccgggcg gctcggcgag       960
     atcgccgtgc aatcgccgga cctgaccagc gggtacctcg aacccgacgg cggcgtccgc      1020
     ccgctcccgc ccgggccgca ccggaccggg gacgtcgggt tcgtcgacga ggacggccac      1080
     gtcttcgtgc tcggccgtcg cggcgcggtg caccggatgg ggcacacgct ctacccggat      1140
     gttctcgcgc acaaggccgc cgcgtgcggg gcgccggtcc acgtgctggc caccgaggac      1200
     gagcgaaccg ggtgccagct cgttttcgtc gtcgccgacc cgcgcctgcg cgccggcggg      1260
     tactggcgca ggcggatcca ggacgtgctg ccttcctacg agcatcccaa ccgcgttgtc      1320
     gtcgtggagg aaatgccgtt gaacagcaat gggaagcccg acaccggaca gctcgaccgg      1380
     ctcctgcgcg gcaccgcgtc cggcggggcc tccagcccgg cggtccccgc ccagacccgt      1440
     cgcggcccca ccccgcgcaa cgctcgcatc ccgttcgccg agcgcctgga cgcgctgcgg      1500
     gcggtggagg acttcctgcg gaacgagcgc ggcgcggtgc tcgacgtcct caccgagatc      1560
     tccccgctca agaccgccga gagcgagctc gccagctcgc tggccacgct ggccggtgcc      1620
     cgcgccgagg tcgagcgcca cggcccgcgg cggctgtccc ggctcgcggt cttcatgccg      1680
     tccaacgtgc tctgctactc ctacgtgctc tacctgctgg tgcccgcgct ctacgcggag      1740
     cggatcgcct tccgggcctc cgcgcaggtc ggggcccccg cgcggcggct gcacgagctg      1800
     ctcgccccgg tgcacggcct gccggtccac ccgcaccagg tgagccagcg gcgcttcgtc      1860
     gacgagccgg tgtcggaggc cgacgtcgtg gtgttcaccg gcgcctacga caacgccgag      1920
     cagatccggt cccgcctgcg ccccgaacag ctcatgctgt tcttcggcca gggcgtcaac      1980
     ccgttcgtcg tcgcgtccgg cgccgacctc gacctcgcgg tggccgacgc ggtccgcatc      2040
     cggatgctca actccgggca ggactgcttc gggccggacg tgttcctggt cgacgcggcg      2100
     gaggcggacc gcttcgtcga gctgctggtg aagcggctgg gcgagctgcg ctacggcgac      2160
     taccgcgacg ccgacgccga ctacgggccg ctgttctacg acagcgcgct gcagaaggcc      2220
     accgagtacc tgcggcgcaa ccacgagcgg atcgtgttcg gcggccgggt cgacctgcgc      2280
     gaccggcatc tgcacccgac cgtgctggtg cgttcgtcca gcgacgatct ggtggtcgag      2340
     gagctgttct cgccgatctt caacgtcgtc gtgcaccacg accgcgagca gctgcgggcg      2400
     gtgctgcgca cgccgttcgt caccgaccgg gcgatggcgg cgatggtcta cggcgacgac      2460
     ccggagacgg tggagctgct ggccaggcgc caccaggtct gccacaaccg cagcatcctc      2520
     gacgccgaga acggcaaccg cccgttcggc gggcacggga tcgtggcgaa ctacgcggcc      2580
     caccgcggca ggcgggtcgc cgaaccgctg ctggtctcca aggccgtcgc cgaccacctg      2640
     tccgcggcct ccgacgtgat cggtggccgg tga                                   2673
//

If you have problems or comments...

PBIL Back to PBIL home page