(data stored in ACNUC1104 zone)

EMBL: AM420293.PE597

AM420293.PE597       Location/Qualifiers
FT   CDS_pept        672565..673305
FT                   /transl_table=11
FT                   /locus_tag="SACE_0607"
FT                   /product="hypothetical protein"
FT                   /function="Phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99952"
FT                   /db_xref="GOA:A4F7C8"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7C8"
FT                   /protein_id="CAL99952.1"
FT                   /translation="MVKSLRRWIEEDVKPFRDEPVRWLSEQHFFRDPLRPVHADPDVFL
FT                   SPADGVILYQDFLDPDEPVVDIKGSPHTVREALRDDSYAERSLVIGIFMSFYDVHVNRV
FT                   PYSGRLSYRELAPIDTFNRPMLDVEHELLEELRIPVGGSEYLRHNQRVVNRIDVGALHL
FT                   SYYVLQIADYDVNRITPFVLGQQRAVLQGTRFSQIRFGSQVDLVIPLSGEHDLVPLCLP
FT                   GQHVEAGVDALVRIDRRRPGEEQR"
     atggtgaagt cgctgcgccg ctggatcgaa gaggacgtca aaccgttccg cgacgagccg        60
     gtcaggtggt tgtcggagca gcacttcttc cgcgacccgc tgcgcccggt ccacgccgac       120
     ccggacgtgt tcctctcacc tgccgacggg gtgatcctct accaggattt cctcgacccg       180
     gacgagccgg tcgtcgacat caagggcagc ccccacacgg tccgcgaggc cctgcgcgac       240
     gactcctacg ccgagcgcag cctggtgatc ggcatcttca tgtcgttcta cgacgtgcac       300
     gtcaaccggg tgccctactc cggtcgcctg tcctaccgcg agctggcccc catcgacacc       360
     ttcaaccgtc cgatgctcga cgtggagcac gaactgctcg aggaactgcg gatcccggtc       420
     ggcggttcgg agtacctgcg gcacaaccag cgcgtggtga accgcatcga cgtcggagcg       480
     ctgcacctgt cgtattacgt cctgcaaatc gccgactacg acgtcaaccg catcacgccg       540
     ttcgtgctcg gccagcagcg agcggtgctg cagggcacgc ggttctcgca gatccggttc       600
     ggctcgcagg tcgatctggt catcccgctg tccggcgagc acgacctcgt cccgctctgc       660
     ctgccgggtc agcacgtcga ggcaggagtc gacgcgctcg tgcgcatcga ccggagacgg       720
     cccggagagg agcagcggtg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page