(data stored in ACNUC1104 zone)

EMBL: AM420293.PE60

AM420293.PE60        Location/Qualifiers
FT   CDS_pept        83325..83432
FT                   /transl_table=11
FT                   /locus_tag="SACE_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99415"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U1"
FT                   /protein_id="CAL99415.1"
FT                   /translation="MTPALGWWWRPARVRICSRGLSRRARTTLSRLQRL"
     atgacgcccg cgctgggctg gtggtggcgt ccggcgcggg tgcggatctg ctcgcgcggg        60
     ctgtcacgca gggcgaggac gacgttgtcg cggctgcagc ggttgtag                    108
//

If you have problems or comments...

PBIL Back to PBIL home page