(data stored in SCRATCH zone)

EMBL: AM420293.PE602

AM420293.PE602       Location/Qualifiers
FT   CDS_pept        676686..678026
FT                   /transl_table=11
FT                   /locus_tag="SACE_0612"
FT                   /product="probable multidrug efflux transport protein"
FT                   /function="77 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99957"
FT                   /db_xref="GOA:A4F7D3"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D3"
FT                   /protein_id="CAL99957.1"
FT                   /translation="MSEETSFRPGAQAPGEVPDNLTRSSTSDATGGGGMFRSLRERNYR
FT                   YYASGQVVSLTGTWMQRAAQDWLVLELSGGNAAALGVAVALQFMPTLLLTLWAGVAADR
FT                   FDKRRLLIGVQSALGACGFVLGLLDVTGVVVLWHVYALCLVLGCFAAVDAPVRQSFVTE
FT                   MVGPAQVTNAVALNSMTFNLARIVGPAVAGLMITAVGTGWVFLANGLSSVAVVTGLVLM
FT                   DPARLHRSAPLREKRGQLVAGLRYVRGRPDLITLMALVLCIGTFGMNFENTLAVLARNT
FT                   FEREADGYGLLITMLAVGTLSGASLAARRSARGGPRLRLVLIGAAAFGALEVVASVMPG
FT                   YWTFAVALIPVGIAVMTFTTSANATVQLSVDPTVRGRVMGLYMLVFLGGKPLGGLASGW
FT                   LAAELGPRSPLMIGGLLSLAAALVAAGVLARRRAHGGRVGSRREGDS"
     gtgtccgagg agacctcgtt ccggccggga gcccaggccc ccggcgaggt cccggacaac        60
     ctcacgcggt cgtccacatc ggacgccacc ggtggcggtg gcatgttccg ctcgctgcgc       120
     gagcgcaact accgctacta cgcgtccggg caggtcgtgt cgctgaccgg cacctggatg       180
     cagcgggcgg cgcaggactg gctcgtcctg gagctctccg gcggcaacgc ggcggcgctg       240
     ggcgtggcgg tcgcgttgca gttcatgccc accctgctgc tgacgctgtg ggccggggtg       300
     gccgccgacc gcttcgacaa gcgcaggctg ctcatcggtg tgcagagcgc gctcggcgcg       360
     tgcgggttcg tgctcgggct gctcgacgtc accggcgtgg tggtgctgtg gcacgtctac       420
     gcgctgtgcc tggtgctggg ctgcttcgcc gcggtcgacg caccggtgcg ccagtcgttc       480
     gtgaccgaga tggtcgggcc cgcgcaggtc accaacgccg tggcgctgaa ctcgatgacg       540
     ttcaacctgg cccgcatcgt cgggcccgcg gtggccggcc tgatgatcac cgcggtcggc       600
     accggctggg tgttcctggc caacggcctc agctcggtcg ccgtggtcac cgggctggtg       660
     ctcatggacc cggccaggct gcaccggtcc gcgccgctgc gggagaagcg cgggcagctc       720
     gtggcgggcc tgcgctacgt gcgcgggcgc cccgacctga tcacgctcat ggcactggtg       780
     ctctgcatcg gcaccttcgg gatgaacttc gagaacacgc tggcggtgct ggcgcgcaac       840
     accttcgagc gggaggccga cggctacggc ctgctgatca cgatgctcgc cgtcgggacg       900
     ctctccggcg cgtcgctggc cgcccgccgc agcgcccgcg gagggccgcg cctgcggctg       960
     gtgctgatcg gtgccgcggc gttcggtgcg ctggaggtcg tggcgtcggt gatgccgggg      1020
     tactggacgt tcgcggtggc gctgatcccg gtcggcatcg cggtgatgac cttcaccacc      1080
     agcgcgaacg cgacggtgca gctctcggtc gatccgaccg tgcgcggccg ggtcatgggg      1140
     ctctacatgc tggtcttcct gggcggcaag ccgctgggcg ggctcgcgtc gggctggctg      1200
     gcggcggagc tcggcccgcg gtcgccgctg atgatcggtg gcctgctgtc gctggcggcc      1260
     gcgctcgtcg cggcgggtgt gctagcccgc cgcagagcgc acggtggccg cgtcgggagc      1320
     cgccgggaag gcgattccta g                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page