(data stored in ACNUC1104 zone)

EMBL: AM420293.PE604

AM420293.PE604       Location/Qualifiers
FT   CDS_pept        679005..679652
FT                   /transl_table=11
FT                   /locus_tag="SACE_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99959"
FT                   /db_xref="GOA:A4F7D5"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D5"
FT                   /protein_id="CAL99959.1"
FT                   /translation="MGNASRAPRASFACGLAGAVLFVVVFLVAGALRPGYSALRHPVSS
FT                   LALGESGRVQSTSFVATGVLMFAFAVGVRRTAGGLWLSRLLGVYAIGLAGAGFFRTDPI
FT                   SGYPAGTPALGQSTLTGSLHDTFSALVFAALPLACGVLARRCFKSGRTGWAWYSVATAV
FT                   VFLAGFVLAGVGFAQNAALLPVAGLLQRLTLVVGWVWVGALAAHLLRRSAPA"
     atgggaaacg cctcgcgcgc gccgcgcgcg tccttcgcgt gcgggttggc cggcgccgtg        60
     ctgttcgtcg tcgtgttcct cgtcgccggt gcgctgcggc ccggctacag cgcgctgcgc       120
     cacccggtga gctcgctcgc gctcggggag tccggccggg tgcagagtac gagcttcgtc       180
     gcgaccggcg tgctgatgtt cgcgttcgcg gtgggggtgc ggcgcaccgc gggcgggctc       240
     tggctgtcgc ggctgctcgg cgtctacgcg atcggcctgg ccggggcggg gttcttccgg       300
     accgacccga tcagcgggta cccggccggc acgccggcgc tggggcagag cacgctcacc       360
     gggtcgctgc acgacacctt ctccgcgctc gtcttcgccg cgctgccgct ggcgtgcggg       420
     gtcctggccc gccgctgctt caagtccggc cgcaccggct gggcctggta ctcggtcgcg       480
     accgcggtgg tgttcctggc cgggttcgtg ctcgccggcg tgggcttcgc ccagaacgcc       540
     gcgctgctgc cggtcgcggg cctgctgcaa cggctcacgc tcgtcgtggg ctgggtgtgg       600
     gtcggcgcgc tcgccgcgca cctgctgcgc cggagcgcgc ctgcatag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page