(data stored in ACNUC1104 zone)

EMBL: AM420293.PE606

AM420293.PE606       Location/Qualifiers
FT   CDS_pept        680028..680969
FT                   /transl_table=11
FT                   /locus_tag="SACE_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99961"
FT                   /db_xref="GOA:A4F7D7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D7"
FT                   /protein_id="CAL99961.1"
FT                   /translation="MTLAIGLLAGAVFIALSGPLYLRAVVSPRVRPGVALTVWVASAAV
FT                   VVTGAVTGAVLLVLPHRGAADHLIGMAWTCVNAVHAGGEPVWEHVLRLGAALPVFAATV
FT                   RTLFVAYRLTRRDAGRRRHHLRLLRALSTAEPDSAVLWLEQATPVAYSLGGRRGAIVAT
FT                   TGVSRLGAAERDAILAHERAHLSGNHHRLVLMADVLARALPFVPLFRAAPPMVRVLVEL
FT                   AADAAAATRCGPGPVRSALRAVSGAGVPAGSLAMSREAVELRLRWLGAARGSRRGRTGY
FT                   LAAVFAAAAPAMAAVGVVAGLVLLYCLSDGRL"
     gtgacactgg ccatcgggct gctcgcgggc gcggtcttca tcgccctgtc cgggccgctc        60
     tacctgcgcg ccgtggtgag cccgcgggtg cgtccgggcg tcgcgctgac ggtctgggtc       120
     gcctccgccg cggtcgtcgt caccggagcg gtgaccggtg cggtcctgct ggtgctgccg       180
     caccgcggcg cggccgacca cctgatcggc atggcctgga cctgcgtcaa cgccgtccac       240
     gccggtggcg aaccggtgtg ggagcacgtc ctgcgcctgg gcgcggcgct gccggttttc       300
     gccgccacgg ttcggacgct gttcgtcgcg taccgcctga ccaggcgtga cgccggaagg       360
     cgtcggcatc acctgcggct gctgcgggcc ctgtccaccg ccgaacctga ttcggcggtg       420
     ctgtggctgg agcaggccac cccggtcgcc tacagcctcg gcggccggcg cggcgcgatc       480
     gtggcgacca ccggcgtctc ccggctcggc gccgccgagc gcgacgcgat cctcgcgcac       540
     gagcgcgcgc acctgtccgg caaccaccac cgcctcgtgc tgatggccga cgtcctcgcg       600
     cgggcgctgc cgttcgtccc gctgttccgg gccgcgcccc cgatggtgcg ggtgctggtg       660
     gagctcgccg ccgacgccgc tgccgcgacg cgctgcgggc cgggcccggt gcggtccgcc       720
     ctgcgcgccg tgagcggggc gggggtgccc gccggttcgc tggcgatgtc gcgggaggcg       780
     gtggagctgc ggctgcgctg gctgggcgcc gcgcggggtt cccggcgcgg gcgcaccggc       840
     tacctcgcgg cggtgttcgc cgcggccgcg cccgcgatgg ccgcggtcgg tgtcgtcgcc       900
     ggtctggtgc tgctctactg cctgtccgac ggtcggctct ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page