(data stored in ACNUC1104 zone)

EMBL: AM420293.PE607

AM420293.PE607       Location/Qualifiers
FT   CDS_pept        681012..681710
FT                   /transl_table=11
FT                   /locus_tag="SACE_0617"
FT                   /product="DsbA-like thioredoxin domain protein"
FT                   /function="Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99962"
FT                   /db_xref="GOA:A4F7D8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D8"
FT                   /protein_id="CAL99962.1"
FT                   /translation="MGKAKVRRLNVLAGVLAAAVVFLLGYVLATQNRGDAPPAPEPAPQ
FT                   AQQNPLESLARRDPGDPLAKGRPDAPVVLVNYTDFRCPFCAKFGRDIEPELQRRYVDTG
FT                   VLRIEWRDFPIFGEESLSAAEAGRAAARQGRFWEFHDAVFAQAPPTGHPPMPRERLVEL
FT                   ARQAGVPDIQRFEADMGDPGVYAGIQADAMEGAQLGVSSTPTFVINGQPVFGAQPLEVF
FT                   TEVIEQARAR"
     gtgggcaagg cgaaggtccg tcggctcaac gtgctggcgg gtgtgctggc cgcggcggtg        60
     gtgttcctgc tcgggtacgt gctggcgacg cagaaccgcg gcgacgcgcc gcccgcgcct       120
     gagcccgcac cgcaggcgca gcagaacccg ttggagtcgc tggcccggcg cgaccccggc       180
     gacccgctgg ccaagggacg tccggacgcc ccggtggtgc tggtcaacta caccgacttc       240
     cgctgcccgt tctgcgccaa gttcggccgc gacatcgaac cggagctcca gcgccgctac       300
     gtcgacaccg gcgtcctgcg catcgagtgg cgcgacttcc cgatcttcgg cgaggagtcg       360
     ctgtcggcgg ccgaggccgg gcgcgcggcg gcccggcagg gcaggttctg ggagttccac       420
     gacgccgtct tcgcccaggc gccgccgacc ggccacccgc cgatgccgcg ggagcggctg       480
     gtggagctgg cccggcaggc cggcgtgccc gacatccagc ggttcgaggc cgacatgggc       540
     gatcccgggg tctacgcggg catccaggcc gacgccatgg agggcgcgca gctcggggtg       600
     tcgagcacgc ccaccttcgt gatcaacggg cagccggtgt tcggcgccca gccgctggag       660
     gtcttcaccg aggtcatcga gcaggcacgg gcgcgatga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page