(data stored in ACNUC1104 zone)

EMBL: AM420293.PE608

AM420293.PE608       Location/Qualifiers
FT   CDS_pept        681707..682567
FT                   /transl_table=11
FT                   /locus_tag="SACE_0618"
FT                   /product="integral membrane cytochrome biogenesis protein"
FT                   /function="Cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99963"
FT                   /db_xref="GOA:A4F7D9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7D9"
FT                   /protein_id="CAL99963.1"
FT                   /translation="MTEIGLVGAFLGGLLSLLSPCSALLLPSFFAYAFNGIGRLVARTS
FT                   VFYAGLCVTLVPLGAAAGLFGALLTSYRDTVTLAGGLVLVGLGLLQISGRGFGISAAQQ
FT                   LTGRIRVSSNLSVFALGAVYGLAGFCAGPLLGSVLTVSATGGDPLYGAVLLAVFALGMA
FT                   FPLFVLAVLWDRFDIRNRKWLRGREIGVGRLRVHTANLVSGLVFVAIGVLFVVTDGTAN
FT                   LGGLADVDGQFAVQVWLRRAVAGVTDAQVLLVVAVVALVAVLWRIRHVERKADQDAERE
FT                   PADRE"
     atgaccgaga tcggcctcgt cggcgcgttc ctcggtggcc tgctgtcgct gctcagccca        60
     tgctcggcgc tgctgctgcc ctccttcttc gcctacgcct tcaacggcat cggcaggctg       120
     gtcgcccgca cctcggtctt ctacgccggt ctttgcgtga cgctggtgcc gctgggcgcg       180
     gcggcagggc tcttcggcgc gctgcttacc tcctaccgcg acaccgtcac gctggccggc       240
     ggtctcgtcc tcgtcggact cggactgctc cagatctcgg ggcggggctt cggcatcagc       300
     gcggcgcagc agctcaccgg ccggatcagg gtttcgtcga acctgtcggt cttcgcgctc       360
     ggcgccgtat acggtttggc ggggttctgc gccgggccgc tgctcggcag cgtgctcacg       420
     gtgtcggcga ccggtggaga cccgctctac ggcgccgtgc tgctcgcggt cttcgcgctg       480
     ggcatggctt ttccgctgtt cgtgctcgcc gtgctgtggg accgcttcga catccgcaac       540
     cggaagtggc tgcgcgggcg ggagatcggc gtcggccgct tgcgggtgca caccgcgaac       600
     ctggtgtccg gcctggtgtt cgtcgccatc ggcgtgctgt tcgtggtgac cgacgggacc       660
     gccaatctcg gtggcctggc cgatgtggac ggtcagttcg cggtgcaggt gtggcttcgc       720
     cgcgccgtcg ccggggtcac cgacgcccag gtcctgctcg tggtggcggt ggtcgcgctc       780
     gtggccgtcc tctggcgcat ccgccacgtc gagcgcaagg ccgaccagga cgccgagcgg       840
     gaacccgctg accgggaata g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page