(data stored in ACNUC1104 zone)

EMBL: AM420293.PE610

AM420293.PE610       Location/Qualifiers
FT   CDS_pept        683738..684682
FT                   /transl_table=11
FT                   /locus_tag="SACE_0620"
FT                   /product="putative iron ABC transporter binding protein"
FT                   /function="ABC-type Fe3+-hydroxamate transport system"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99965"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7E1"
FT                   /protein_id="CAL99965.1"
FT                   /translation="MRRLLVVLATTLLLAGCGTAASTGPAWEGMRVENCGRTQVIAEPP
FT                   RRVVSLNQHATEILLALGLGDRLVGTAYPDDRTPPASVAADYARVPLLAVEYPSAERIL
FT                   EAEPDLVVGGYSSAFDEGEGRGREALESKGIATLLLSESCATGPTGMPALLADIDMFGS
FT                   VLGLRERASVLAADIEGRVRAVEQRLAGVPPVDVFVYDSGEQAAFTLGGHGVGNDALTR
FT                   AGARNVFADVPEGFADVSWEQVASRAPRAIVLVDYLAKPVHDKRAYLEGHPLASGTPAV
FT                   RADRYSTVPLVELTEGIRFPDAVERLARDLHGA"
     atgcgacgcc tgctcgtggt gctggccacc accctcctgc tggccggctg cggcaccgcg        60
     gcctcgacgg gacccgcctg ggaggggatg cgcgtcgaga actgcgggcg gacgcaggtc       120
     atcgccgagc cgccgcggcg cgtggtcagc ctgaaccagc acgcgaccga gatcctgctg       180
     gcgctcggcc tcggggaccg cctcgtcggc accgcctacc cggacgaccg cacgcccccg       240
     gcgtcggtgg ccgccgacta cgcgcgggtg ccgctgctgg ccgtggagta cccgtcggcc       300
     gagcgcatcc tcgaagccga gcccgacctg gtggtcggcg ggtactccag cgcgttcgac       360
     gagggcgagg gccgcggccg ggaggcgctg gagagcaagg gcatcgcgac gctgctgctg       420
     tcggagtcgt gcgccaccgg accgaccggg atgcccgcgc tgctggccga catcgacatg       480
     ttcggcagcg tgctgggcct gcgggagcgg gcgtcggtgc tggccgccga catcgagggc       540
     cgcgtccgcg cggtcgaaca gcgcctggcg ggcgtgccac cggtcgacgt cttcgtctac       600
     gactccggcg agcaggcggc cttcaccctc ggcggccacg gcgtcggcaa cgacgccctc       660
     acgcgagccg gggcccgcaa cgtcttcgcc gacgtcccgg agggcttcgc ggacgtgagc       720
     tgggagcagg tcgcctcccg cgctccgcgg gcgatcgtgc tggtggacta cctggccaag       780
     cccgtgcacg acaagcgcgc ctacctcgag ggccatccgc tggcctcggg cactccggcg       840
     gtgcgggccg accgctacag cacggtcccg ctggtcgagc tgaccgaggg catccgcttc       900
     ccggacgccg tcgagcggct ggcgcgggac ctgcacggcg catga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page