(data stored in ACNUC1104 zone)

EMBL: AM420293.PE62

AM420293.PE62        Location/Qualifiers
FT   CDS_pept        85308..86507
FT                   /transl_table=11
FT                   /locus_tag="SACE_0064"
FT                   /product="amino acid aldolase or racemase-like"
FT                   /function="predicted amino acid aldolase or racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99417"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U3"
FT                   /protein_id="CAL99417.1"
FT                   /translation="MLKALPESRRLDTATIELDPPFAVADLDAFHRNAADLVRRAAGRP
FT                   VRVATKSVRCRELLRRTLTTPGFAGLMCYSLAEALWLHGDGLSEDVLVAYPTADRGALR
FT                   QLVARPTAAAAITIMVDSVEHLDLVDAAVGTRRPEIRVCLDIDASWRPLPAMHIGTRRS
FT                   PVHTAADARRLAEAVVRRAGFRLAGLMAYEGQIAGLGDAPPGSPLRGAGVRWMQRRSAA
FT                   ELAGRRAEIVTAIRELAELEFVNGGGTGSIETTTAESAVTEVAAGSGLVGPTLFDAYRS
FT                   FRPEPALLFALPVVHRPGGRVATVFGGGYIASGPVGADRAPTPYLPTGLKLTAVEGAGE
FT                   VQTPVAGHAARRLRLGDRVWFRHAKAGELAERFNEYHLVDGDRVADSVPTYRGEGRSFG
FT                   "
     gtgctcaagg cgctccccga gtcgcgacga ctcgacacgg ccaccatcga actcgacccg        60
     ccgttcgcgg tggccgacct cgacgcgttc caccgcaacg ccgccgacct ggtgcgacgt       120
     gcggcgggac ggccggtgcg ggtggccacc aagtcggtgc ggtgccggga actgctgcgc       180
     aggaccctga cgacgcccgg cttcgccggc ctcatgtgct acagcctcgc cgaggcgctc       240
     tggctgcacg gcgacggact cagcgaggac gtcctggtcg cctacccgac ggccgaccgg       300
     ggagcgctgc gccaactcgt ggcgcgtccg acggccgcgg ccgccatcac gatcatggtc       360
     gactcggtcg agcacctgga cctggtcgac gccgccgtcg gtacgcgccg cccggaaatc       420
     cgggtgtgcc tggacatcga cgcgtcctgg cggccgctgc ccgccatgca catcggcacc       480
     cggcgctcgc cggtgcacac cgccgcggac gcgcggcggc tcgccgaggc agtggtgcgc       540
     cgcgctgggt tccggctcgc gggcctgatg gcctacgaag gccagatcgc cgggctcggt       600
     gatgccccgc ccggcagccc gctgcgcggg gcgggggtgc ggtggatgca gcgccggtcc       660
     gccgccgagc tcgccgggcg ccgggccgag atcgtcaccg cgatccggga actggccgag       720
     ctggagttcg tcaacggcgg cggcaccggc agcatcgaga ccaccaccgc cgagtccgcc       780
     gtcaccgagg tcgccgccgg gtccgggctg gtcgggccga cgttgttcga cgcgtaccgg       840
     tctttccggc cggagcccgc cctgctgttc gcgctgcccg tagtgcaccg ccccggcggc       900
     cgggtggcga cggtgttcgg cggcggctac atcgcgtccg ggccggtcgg cgccgaccgc       960
     gcaccgacgc cttacctgcc cacggggctg aagctgaccg ccgtcgaagg cgcgggcgag      1020
     gtgcagacgc cggtcgccgg gcacgccgcc cggcggctgc gcctgggcga ccgggtctgg      1080
     ttccgccacg ccaaggccgg cgagctcgcc gagcggttca acgagtacca cctggtcgac      1140
     ggcgaccggg tggccgactc ggtgcccacc taccgcgggg agggcaggtc cttcggttga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page