(data stored in ACNUC1104 zone)

EMBL: AM420293.PE630

AM420293.PE630       Location/Qualifiers
FT   CDS_pept        complement(702356..702952)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0640"
FT                   /product="putative integral membrane protein"
FT                   /function="predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99985"
FT                   /db_xref="GOA:A4F7G1"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7G1"
FT                   /protein_id="CAL99985.1"
FT                   /translation="MGEEAGGRVLALSDGVFAIAATLLALDLRVPEGLPSGELHAALHR
FT                   MVPPLQGYAIAFLVIGVLWLGHHQLFALMHRIGPRVAALNVLLLGLVALLPFPSSVVND
FT                   YDDEPVVVISYALNVCLIALVQVAIVAVALHEGDFVPGVTRARAYVPSAITAGVFLVSV
FT                   PLALVSTQWAMLSWLLLIPGHFVEARVNRDPRSGG"
     atgggcgagg aggcgggcgg ccgggtcctg gcgctctccg acggcgtgtt cgcgatcgcc        60
     gcgacgctgc tcgcgctcga cctgcgggtg ccggaggggc tgccgtccgg cgagctgcac       120
     gccgcgctcc accgcatggt gcccccgttg cagggctacg ccatcgcctt cctggtgatc       180
     ggcgtgcttt ggctgggcca ccaccagctc ttcgcgctga tgcaccggat cggcccgcgc       240
     gtcgccgccc tgaacgtgct gctgctcggg ttggtcgcgc tgctgccgtt cccgtcgtcg       300
     gtggtcaacg actacgacga cgagccggtc gtggtgatct cctacgcgct gaacgtgtgt       360
     ttgatcgcac tggtacaggt ggcgatcgtg gccgtggccc tgcacgaggg cgacttcgtg       420
     cccggggtca ccagggcacg tgcgtacgtg ccgtcggcga tcaccgcggg ggtgttcttg       480
     gtctccgttc cactcgccct ggtcagcacg cagtgggcga tgctgagctg gttgttgctg       540
     ataccggggc acttcgtgga agcccgcgtc aaccgcgatc cgcggagcgg tggttga          597
//

If you have problems or comments...

PBIL Back to PBIL home page