(data stored in ACNUC1104 zone)

EMBL: AM420293.PE633

AM420293.PE633       Location/Qualifiers
FT   CDS_pept        705569..706942
FT                   /transl_table=11
FT                   /locus_tag="SACE_0643"
FT                   /product="cationic amino acid transporter, APC family"
FT                   /function="Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0643"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99988"
FT                   /db_xref="GOA:A4F7G4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7G4"
FT                   /protein_id="CAL99988.1"
FT                   /translation="MNDDAPGGAQNPGLKKVMGPKLLLFFVVGDILGTTIYSLTGKVAG
FT                   KVGGALWIPFLVAFLVAFLTAFSYLELVGKYPKAGGAPLYVHRAFGVHFVTFLIAFAVM
FT                   CSGITSASSAAQAFSGDYLEAIVPGVPAWPVAIGFLLILAGINLRGVGESVKMNVVLTC
FT                   VELTGLLIVIVFGAFAVFGGSSNPDLVPDPSRLTQFNADTSPLLAITSATALAFFAMVG
FT                   FEDSVNMAEETKNPAKNFPRALLMGLSITAAIYLVIALITSTLVPTAELAESDGPLLLV
FT                   VQAAAPWFPPILFSAIALFAVTNTALINMLMASRLVYGMAQEKIIPKQFGAVHRTRQTP
FT                   WVSILFTSIIAMVLVSLLDISDLGSTTSLLLLAVFAVVNVAVLVLRKHKVEHEHFQAPT
FT                   WVPVLGALSCAFFASPLSGRPVDEYLIAGALLGIGVIFWVINYFVTGGTRFDAAKLSK"
     gtgaacgacg acgcgcccgg cggtgcgcag aaccctggcc tcaagaaggt catgggtccg        60
     aaactgctgc tgttcttcgt ggtgggagac atcctcggga ccacgatcta ctccctgacc       120
     ggcaaggtcg ccggcaaggt cggcggcgcg ttgtggatcc cgttcctggt cgcgttcctc       180
     gtggcgttcc tgaccgcctt cagctacctg gaactggtcg gcaagtaccc gaaggcgggc       240
     ggcgccccgc tgtacgtgca ccgcgccttc ggcgtgcact tcgtgacgtt cctgatcgcc       300
     ttcgcggtga tgtgctccgg catcacctcg gcgtcgtcgg ccgcgcaggc cttcagcggt       360
     gactacctgg aggccatcgt cccgggagtc ccggcgtggc cggtggcgat cggcttcctg       420
     ctgatcctgg ccggcatcaa cctccgcggc gtcggcgagt cggtgaagat gaacgtggtg       480
     ctgacctgcg tcgagctcac cggtctgctg atcgtcatcg tcttcggcgc gttcgccgtc       540
     ttcggcggca gcagcaaccc ggacctggtg cccgacccga gcaggctcac ccagttcaac       600
     gccgacacct cgccgctgct ggcgatcacc tcggccaccg cgctggcgtt cttcgcgatg       660
     gtcggcttcg aggactcggt caacatggcc gaggagacca agaacccggc gaagaacttc       720
     ccgcgcgcgc tgctgatggg tctgagcatc acggccgcga tctacctggt catcgcgctg       780
     atcacctcga cgctggtgcc caccgccgag ctcgccgagt ccgacggccc gctgctgctg       840
     gtcgtgcagg ccgccgcgcc gtggttcccg ccgatcctgt tctcggcgat cgcgctgttc       900
     gcggtcacca acaccgcgct gatcaacatg ctgatggcca gcaggctcgt ctacggcatg       960
     gcgcaggaga agatcatccc caagcagttc ggcgcggtgc accgcacccg ccagacgccg      1020
     tgggtgtcga tcctgttcac cagcatcatc gcgatggtcc tggtcagctt gctggacatc      1080
     tccgacctcg gcagcaccac ctcgctgctg ctgctcgcgg tgttcgccgt ggtcaacgtc      1140
     gcggttctgg tgctgcgcaa gcacaaggtc gagcacgagc acttccaggc gcccacctgg      1200
     gtgccggtgc tgggtgcgct cagctgcgcg ttcttcgcca gcccgctgtc gggccgcccg      1260
     gtcgacgagt acctcatcgc gggtgcgctg ctgggcatcg gcgtgatctt ctgggtgatt      1320
     aactacttcg tcaccggcgg gacacgattc gacgccgcca agctcagcaa gtag            1374
//

If you have problems or comments...

PBIL Back to PBIL home page