(data stored in ACNUC1104 zone)

EMBL: AM420293.PE640

AM420293.PE640       Location/Qualifiers
FT   CDS_pept        complement(714930..716198)
FT                   /transl_table=11
FT                   /gene="cypA"
FT                   /locus_tag="SACE_0651"
FT                   /product="cytochrome P450-like enzyme"
FT                   /function="Cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99995"
FT                   /db_xref="GOA:A4F7H1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7H1"
FT                   /protein_id="CAL99995.1"
FT                   /translation="MQPDQSPTPRPESRHSPAAACPHAAVHREERPGGLVTWQISAFSE
FT                   ARAALGDSRFSKDPRRLGEALRAGGRSMFAEYGDNLLDNLLNSDPPDHTRLRRLVGKAF
FT                   SPATIERLGPTTQRLADELVASMLPAGRADLLAQFAYPFAFGVIARVLGLPPDSYRIFQ
FT                   RWTESMTAPREQGTDRMVAARHLCEHVTELVRRSREWLASAPAETLLDELVSARDDGDR
FT                   LSENELVATVLLLIIAGHETTVNLIGNGVHALLQHPGQLALLRDHPDLIDGAVEELLRF
FT                   QPPISKTTLRVTTTDVEVAGTEIPAGSIVNVLVPAANRDQRQFPDADRLDITRPPSAHM
FT                   SFGHGIHYCIGAPLARMEGRIAIGALLRGLPGLRLAEPAAEIPWRASNILRGLQRLPVR
FT                   FDSAGADDEVRDRRHAGAARVHA"
     gtgcagcccg accagtcccc caccccccgg cccgagtccc gccacagccc cgcggccgcc        60
     tgcccgcacg ccgcggtgca ccgcgaggaa cgccccggcg gcctggtgac ctggcagatc       120
     agcgctttct ccgaggcgcg tgccgcgctc ggggacagca ggttcagcaa ggacccccgg       180
     cggctcggcg aggcgctgcg cgccggcggc aggtcgatgt tcgccgagta cggcgacaac       240
     ctgctcgaca acctcctcaa cagcgacccg cccgaccaca ccaggctgcg caggctggtg       300
     ggcaaggctt tctcgcccgc caccatcgaa cggctcggac ccacgaccca gcggctcgcc       360
     gacgaactgg tcgcctcgat gctgcccgcg ggccgggccg acctgctcgc gcagttcgca       420
     tacccgttcg cgttcggtgt gatcgcgcgc gtcctcggtc tcccgcccga ctcctaccgg       480
     atcttccagc gctggaccga gtcgatgacc gcgccccgcg agcagggcac cgaccgcatg       540
     gtcgccgcgc gacacctgtg cgaacacgtg accgagctgg tgcgccgcag ccgggagtgg       600
     ctggccagcg caccggccga gacgctgctc gacgagctgg tcagcgcccg cgacgacggc       660
     gaccggctgt cggagaacga gctcgtcgcc accgtgctgc tgctgatcat cgccggccac       720
     gagaccacgg tgaacctcat cggcaacggc gtgcacgcgc tgctccagca ccccggccag       780
     ctcgccctgc tccgcgacca cccggacctg atcgacggcg cggtggagga gctgctgcgc       840
     ttccaaccgc cgatcagcaa gacgacgctg cgcgtcacga cgaccgacgt cgaggtggca       900
     ggcaccgaga tcccggcagg cagcatcgtc aacgtgctgg tccccgccgc caaccgcgac       960
     cagcggcagt tccccgatgc cgaccggctc gacatcacgc ggcccccgtc ggcgcacatg      1020
     tcgttcggcc acggcatcca ctactgcatc ggcgcgccgc tggcccggat ggagggccgc      1080
     atcgccatcg gcgcgctgct gcgcgggctc cccgggctcc ggctcgccga acccgccgcg      1140
     gagatcccct ggcgcgccag caacatcctg cgcggactgc aacgcctccc ggtccgcttc      1200
     gactccgccg gggccgacga cgaggtgcgc gaccgccgcc acgccggtgc cgcgcgggtg      1260
     cacgcgtga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page