(data stored in ACNUC1104 zone)

EMBL: AM420293.PE65

AM420293.PE65        Location/Qualifiers
FT   CDS_pept        complement(91437..91775)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99420"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U6"
FT                   /protein_id="CAL99420.1"
FT                   /translation="MDEILGQVLRNAVWERLDVLTELANRADAPSLLAVARSELPRLTE
FT                   GWRTLLSAHDADEKGNCPECSSRWRPCKAPCTVWRSAYEHLVSGALAPRPARHLRPAHA
FT                   LREVAPVP"
     gtggacgaga tactgggaca ggtgctgcgc aacgcggtgt gggagcggct cgacgtgctc        60
     accgagctgg cgaaccgcgc ggacgcccct tccctgctcg ccgtggcgcg ctccgagctc       120
     cctcgtttga ccgaggggtg gcgcacgctg ctctccgctc acgacgccga cgagaagggc       180
     aactgcccgg agtgctcgag ccgctggcgc ccgtgcaagg caccctgcac ggtgtggcgc       240
     tcggcctacg agcacctggt gagcggcgcc ctggcgcctc gtcccgcacg gcacctgcgc       300
     cccgcgcacg ctctgcgcga ggtggcgccg gtgccgtaa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page