(data stored in ACNUC1104 zone)

EMBL: AM420293.PE652

AM420293.PE652       Location/Qualifiers
FT   CDS_pept        730099..730806
FT                   /transl_table=11
FT                   /locus_tag="SACE_0663"
FT                   /product="protein of unknown function DUF81"
FT                   /function="predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00007"
FT                   /db_xref="GOA:A4F7I3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I3"
FT                   /protein_id="CAM00007.1"
FT                   /translation="MSIGFLVLVAVAVAAAAFVQGATGVGFALIVAPVVGLVEPSLLPV
FT                   LLLVLMIPLNLYVAGRERGSLDRTGAGWITAGRFAGTFGGLWVLAAIPLAQLNLLVGGS
FT                   TVLAAVVTLLAPSFSPGRAAFLTAGAVTGVTETATGVGGPPLALVYQHSPAPVLRSTVA
FT                   VCFLAGELISLVVLLATERIRAEQLWLALLLLPAVVLGALLSRFVHHRLDGRLMRLLVQ
FT                   VFAIVSGVVLLFA"
     gtgagcatcg gtttcctggt gctcgtcgcg gtcgccgtcg ccgcggccgc gttcgtgcag        60
     ggtgccaccg gagtcgggtt cgccctgatc gtcgcgccgg tcgtcgggct ggtcgagccg       120
     tcgctgctgc cggtcctgct gctggtgctg atgatcccgc tcaacctcta cgtcgcgggg       180
     cgcgaacgcg gcagcctgga ccgcaccggc gcgggctgga tcaccgccgg acgcttcgcg       240
     ggcacgttcg gcgggctgtg ggtgctggcg gccatcccgc tcgcgcagct caacctgctc       300
     gtcggcggct cgaccgtgct ggccgccgtg gtcacgctgc tggcgccgag cttcagcccg       360
     ggccgtgcgg cgttcctgac ggcgggggcg gtcaccgggg tcaccgagac cgcgaccggg       420
     gtgggtggtc cgccgctcgc gctggtctac cagcacagcc cggcgccggt gctgcgctcg       480
     acggtcgcgg tctgcttcct ggcgggcgag ctgatctcgc tcgtcgtgct gctggccacc       540
     gagcgcatcc gggccgagca actgtggctt gcgctgttgc tgctgcccgc ggtggtgctc       600
     ggcgcgctgc tcagccggtt cgtgcaccac cggctcgacg gcaggctgat gcgcctgctc       660
     gtgcaggtct tcgcgatcgt ctccggcgtc gtgctgctct tcgcctga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page