(data stored in ACNUC1104 zone)

EMBL: AM420293.PE655

AM420293.PE655       Location/Qualifiers
FT   CDS_pept        complement(732733..733122)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00010"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7I6"
FT                   /protein_id="CAM00010.1"
FT                   /translation="MSEQVPASVRYKELAAAATTAAQRMRRHEQEKAAELEESVTRGNS
FT                   RKKEADQQREQVEKDVRIRWNLALEALWDERWLKVSSLPEPDLSAPPATPEESRRTVQD
FT                   AFLELHDALDKPRWSAGSLLRRKSG"
     atgagtgagc aggtgcccgc ctcggtgcgg tacaaggagc tcgccgcggc ggccaccacc        60
     gccgcgcagc ggatgcgcag gcacgagcag gagaaggccg ccgagctgga ggagtcggtg       120
     acccgcggca acagccgcaa gaaggaggcc gaccagcagc gcgagcaggt cgagaaggac       180
     gtgcggatcc gctggaacct ggcgctggag gcgctgtggg acgagcggtg gctgaaggtc       240
     agcagcctgc cggagccgga cctgtccgca ccgcccgcca cccccgagga gtcacgccgc       300
     acggtccagg acgccttcct cgaactgcac gacgcgctgg acaagccgcg ctggtcggcc       360
     gggtccctgc tgcgccgcaa gagcggctga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page