(data stored in ACNUC1104 zone)

EMBL: AM420293.PE659

AM420293.PE659       Location/Qualifiers
FT   CDS_pept        complement(736954..737781)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00014"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J0"
FT                   /protein_id="CAM00014.1"
FT                   /translation="MRPAMSENTELELLITVVAGAEDERAARDACRGLVRRLDGRIVES
FT                   GDCSDEEPGCWSVTISCTGAASGTGPGALSRAVRTFLRELGPDYGRHRVSCEPPTAWTV
FT                   VDNPELVGDLVAGGERMLVEAWTGGSAAFDSFDPLDDPDEPMPEPDPGPSELDEHGRRR
FT                   PRLALLVDVVTERRAGAEWPARALASRLSRNAVVVDWAERPPMVRIELDLGPAVGEPPE
FT                   IVTNAIAQLGGSGWSRLRVDGPRAMARWSAAPTPPSGIAAIELSAAADAANAD"
     atgcgtcccg cgatgtctga aaacaccgag ctggagctcc tcatcaccgt cgtggccggc        60
     gccgaggacg agcgcgccgc gcgcgacgcc tgccgcgggc tcgtgcggcg cctcgacggg       120
     cggatcgtgg agtccggcga ctgctccgac gaggaacccg gctgctggtc ggtgaccatc       180
     agctgcaccg gcgcggcttc cggcaccggg ccgggcgcgc tgtcgcgcgc ggtccggacg       240
     ttcctgcgcg aactcggtcc ggactacggc cgccaccggg tctcctgcga gccgccgacc       300
     gcctggaccg tggtggacaa ccccgagctg gtcggcgatc tcgtcgccgg cggcgagcgg       360
     atgctggtcg aggcgtggac gggtggttcc gccgctttcg actccttcga cccgctcgac       420
     gaccccgacg agccgatgcc cgaaccggac ccgggaccga gcgagctgga cgagcacggc       480
     aggcggcggc cccggctcgc gctgctggtc gacgtcgtca ccgagcgccg ggcgggcgcg       540
     gagtggcccg cgcgggcgct ggcgagcaga ctctcgcgca acgcggtcgt cgtcgactgg       600
     gccgaacgcc cgccgatggt gcgcatcgag ctggacctcg gccccgcggt cggggagccg       660
     ccggagatcg tgaccaacgc gatcgcccag ctcggcggca gcggctggtc gcggctgcgg       720
     gtggacggcc cccgcgcgat ggcccgttgg tcggccgccc ccactccgcc atccggtata       780
     gcggcgatcg agctgtcggc cgccgcggac gccgcgaatg ccgactga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page