(data stored in SCRATCH zone)

EMBL: AM420293.PE66

AM420293.PE66        Location/Qualifiers
FT   CDS_pept        complement(91789..92040)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99421"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5U7"
FT                   /protein_id="CAL99421.1"
FT                   /translation="MDSTEQQGDPAGPAESSGGAGDRTRWWRFHCRDATNAPRDLTVLV
FT                   NRDKVVLVGPPGETAVLSTGGAGELSTALRAAAEQARK"
     gtggacagca ccgagcagca gggagacccg gccggtccgg ccgagtcctc cggcggtgcc        60
     ggcgaccgca ccaggtggtg gcggttccac tgtcgggacg cgaccaacgc gccgcgggac       120
     ctcaccgtgc tggtgaaccg ggacaaggtg gttctcgtcg gaccgccggg cgagaccgca       180
     gtgctttcca ccggcggagc cggtgagctg agcaccgcgc tgcgggctgc cgctgagcag       240
     gcgagaaagt ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page