(data stored in ACNUC1104 zone)

EMBL: AM420293.PE665

AM420293.PE665       Location/Qualifiers
FT   CDS_pept        745061..746002
FT                   /transl_table=11
FT                   /locus_tag="SACE_0678"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0678"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00020"
FT                   /db_xref="GOA:A4F7J6"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J6"
FT                   /protein_id="CAM00020.1"
FT                   /translation="MTTLAVVLAALGAVGYAVGARTQHGAVHDTIGDSGLGLRSQLRLL
FT                   KNVRWLLGLLALGAGAVLHACALGLAPLTVVQPIGVIALPITVLLNVRERGIRVRDLKP
FT                   AMVFAVVASTVGVGAFVVLAAGSATPTPVAPDDQVLATQLVGGGVLALGVFAMMSRSKL
FT                   RCVLFAAGCAVAYGYVSLLTRAVVQQLGTTDLLSLNLWPLFGIGIAMIVGAWLLQHGYA
FT                   SGPPDLIVACLTVIDPIVAVGLGIGLLGEADRVDTWTAIGEVVCAAVACAGVFALARFH
FT                   PENRERRVPTPVTGSSDLAGPSSTDRPDGSTP"
     atgaccacgt tggcggtggt gctcgccgcg ctgggggccg tcggctacgc ggtgggcgct        60
     cgcacgcagc acggggcggt gcacgacacg atcggcgaca gcggtctggg tctgcgcagc       120
     cagctgcggc tgctgaagaa cgtccgctgg ctgctcgggc tgctcgcgct cggcgccggt       180
     gcggtgctgc acgcgtgcgc gctcggtctg gcgccgttga ccgtggtgca gccgatcggt       240
     gtcatcgcgt tgccgatcac ggtgctgctc aacgtccgcg agcgcggcat ccgcgtccgc       300
     gacctcaagc cggccatggt gttcgcggtc gtcgcgagca ctgtcggcgt cggtgctttc       360
     gtggtgctcg cggccggtag cgcgaccccg acgccggtcg cgcccgacga ccaggtgctc       420
     gccacccagc tcgtcggcgg cggggttctc gccctcggcg tcttcgcgat gatgagcagg       480
     tcgaagctcc ggtgcgtgct gttcgccgcg ggatgcgcgg tcgcgtacgg gtacgtctcg       540
     ctgctcacgc gcgcggtggt gcagcagctc ggcaccaccg acctgctgtc gctcaacctg       600
     tggccgctgt tcgggatcgg catcgcgatg atcgtcggtg cctggctgct gcagcacggt       660
     tatgccagcg gtcctcccga cctgatcgtg gcctgcctca cggtgatcga cccgatcgtg       720
     gccgtcgggc tgggcatcgg gctcctcggg gaggccgacc gggtggacac gtggacggcc       780
     atcggcgagg tcgtgtgcgc cgccgtggcc tgcgccgggg tcttcgcgct ggcccgcttc       840
     cacccggaga accgcgagcg gcgcgtaccc acacctgtga ccggcagcag tgatcttgcc       900
     ggaccgagtt cgacagatcg tcctgacggg agtactcctt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page