(data stored in ACNUC1104 zone)

EMBL: AM420293.PE667

AM420293.PE667       Location/Qualifiers
FT   CDS_pept        747416..747760
FT                   /transl_table=11
FT                   /locus_tag="SACE_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0680"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00022"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7J8"
FT                   /protein_id="CAM00022.1"
FT                   /translation="MIALLLASVSMPLPLTVRMSLPAPMRLAVRMPLAALMSLLVGMPL
FT                   AAPKPLAALIPMPPPLSLAPPMSLAPPRLLAAVSWPAPTPMPRPMHAVASSSAMLQRPT
FT                   SADAMPWRPC"
     atgatcgcgc tgctgctggc atcggtgtcg atgccgctgc cgctgaccgt gcggatgtcg        60
     ttgccggcgc cgatgcggtt ggccgtgcgg atgccgttgg cggcgctgat gtcgctgttg       120
     gtggggatgc cgttggccgc cccgaagccg ctggcggcgc tgataccaat gccgccaccg       180
     ttgtcgctgg cgccgccgat gtcgctggcc ccgccgaggc tgttggcggc ggtctcgtgg       240
     ccggcgccga cgccaatgcc gcggccgatg cacgcggtcg cgtcgtcgtc agcgatgctg       300
     cagcggccga cgtcggcgga cgcgatgccg tggagaccgt gctga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page