(data stored in ACNUC1104 zone)

EMBL: AM420293.PE670

AM420293.PE670       Location/Qualifiers
FT   CDS_pept        complement(750607..751323)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0683"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00025"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K1"
FT                   /protein_id="CAM00025.1"
FT                   /translation="MSAHATAVDLHTTRRGPTRQRSSHLTAVPAAPAQGTSRTLTSPPP
FT                   DIPVLRAPERIPLAFRLVGGRRPTRTSRPEPTPTTQLHGRRYGPGRLSSLLRPPSRPGS
FT                   SSTRLRSVLLNLATTVLLVVGTALATATAAHAASAEGPATIEPHACPADSFCAWPSHDF
FT                   QGAAHQTEVSAAPLGRCVALPQDFEATSFANNTGRPVTVYQDGSCSTEADFRTYPTGSF
FT                   VPRSPYVARAIQVWSH"
     atgtctgcgc acgccactgc ggtcgacctg cacaccaccc ggcggggccc gacccgccag        60
     cggtcctcgc acctcaccgc cgtacccgcg gcaccggccc agggcacctc ccgaaccctc       120
     acctcaccgc cgccggacat cccggtgctg cgcgcgcccg aacggattcc cctggcgttc       180
     cgactcgtcg gcggccgacg ccccacccgc acgtcccggc ccgaaccaac ccccacgacc       240
     cagctccacg gacgccggta cggtcccggc cggctgtcct cgctgctccg accgccgagc       300
     aggccagggt cgtcctccac ccggctccgg tccgtcctgc tgaacttggc gaccacggtc       360
     ctcctcgtcg tcggaacggc gctggccacg gccacggccg cgcacgccgc atccgcggaa       420
     ggccccgcca ccatcgagcc gcacgcctgc ccggcggaca gcttctgcgc gtggccgagc       480
     catgacttcc agggggctgc ccaccagacc gaggtatcag cagccccact cggtcgctgc       540
     gtcgcgctac cgcaggactt cgaggcgacc tcgttcgcca acaacaccgg tcggcccgtc       600
     acggtctacc aggacgggtc ctgctccacc gaggccgact tccgcaccta ccccaccgga       660
     tcattcgtgc cacgttcgcc atacgtggcc cgcgcgatcc aggtgtggtc gcactga          717
//

If you have problems or comments...

PBIL Back to PBIL home page