(data stored in ACNUC1104 zone)

EMBL: AM420293.PE676

AM420293.PE676       Location/Qualifiers
FT   CDS_pept        complement(757418..757648)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0689"
FT                   /product="hypothetical protein"
FT                   /function="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0689"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00031"
FT                   /db_xref="GOA:A4F7K7"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K7"
FT                   /protein_id="CAM00031.1"
FT                   /translation="MTAFFIVWYLGYVVLAAYLPDFMATKLWGEVNVGLVMGIGQFATT
FT                   LIITGAYVRFARKHMDPEVEEIRREAIGDQR"
     atgaccgcgt ttttcatcgt ctggtacctc gggtatgtgg tcctggccgc ctacctgccg        60
     gacttcatgg cgaccaagct gtggggcgag gtcaacgtcg gactcgtcat gggcatcggc       120
     cagttcgcga ccaccctgat catcacgggc gcgtacgtcc gcttcgcccg caagcacatg       180
     gaccccgagg tcgaggagat ccgccgcgag gcgatcggtg accagcgatg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page