(data stored in ACNUC1104 zone)

EMBL: AM420293.PE677

AM420293.PE677       Location/Qualifiers
FT   CDS_pept        758562..762005
FT                   /transl_table=11
FT                   /locus_tag="SACE_0690"
FT                   /product="putative signal transduction histidine kinase
FT                   membrane protein"
FT                   /function="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0690"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00032"
FT                   /db_xref="GOA:A4F7K8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7K8"
FT                   /protein_id="CAM00032.1"
FT                   /translation="MATGDTGRGAAVIRWRNWSLTTKLAAVVLVPVIFAITLGVGQIRW
FT                   QVDRADEYDRVAKVLDAVDQIEPLVVSVQEERTRSVDFLTGSIDAGKVDEQAVVVDAAV
FT                   RGTRQVMASPEDYSDVVRERFGELNTELGKLDETRALVRDRRAPAPAVIERYSKLVNSI
FT                   LSLNRALTSTVADRNLSSTASAMQDMVSIMEEVRLQQAWVLTGLAEGSISPQALDQLLG
FT                   SRARLIGKISEARATVAAHWQRRLDQTMTGTAILERNKLATAIVLETTDGKFSGGYSVP
FT                   RDQWNQRSDEVIQLIDEGHDDLGAEVRRIAFDLEDDASSAAGWDSVLLLSALILAAAII
FT                   ITIARQLLGSLRDLRRGALKSANKGLPEAVTSIRAGRKVDSELEPVGVDTDEEVGQVAR
FT                   AFDEVNRQALRLAVEQASLRRGYSEAFVSVSRRSQALLERQLRLFEELEKDEEDPDQLS
FT                   RLFQLDHLATRMRRNNENLMVLSGSDLARRFYQPTELADVLRAAVSEIEQYPRVIVQPP
FT                   PAVKLVGHAASDMVRLVAELLDNAANFSSPDTSVTVSSYQSGDGSVVLDVLDEGIGMGH
FT                   AELASANERLARVDEDDLATSRRMGLFVAGRLAVRHDIGVELHGGPDVEGVRATVTIPA
FT                   EHVVAGDAGRTAPPPPGQGVHRNGSTQHDLPNATSIPAQPAGDDQGFPAADFDPSPSLP
FT                   RRGVSEPTARAEFESSAPLPRRDPSGGLNALDSGSPLPRREPREPSLQQDHGAPATEGD
FT                   LSGPAPLFEPSQPSEAAEEQSESYGAAQQIPPEQPAEQTVNLFTPEPGGTSLDIPHQPR
FT                   TVGQDFAPAWPAVTEEPPRDQVADTSESPIFEEVSTQWFQPATDDAQAHATSGTAEHEF
FT                   AWPDSGQRDRSEVEVDELGLPVGPGAADGLARSDQPRSPGRWEDAGQSPAPSGWSEVGE
FT                   HRSPSGWDDADLARSSGDDADGARSSGGWGESRDPEDWSRSDESRSSDGWGLGAATGQV
FT                   EAGEPAEVGMSQEPAPLTTSGLPRRTPRGAAQAEGAGNSRSASDVSREFSEKYNGVHFG
FT                   QSEPAAPAEAGSAVEDAWNFAADDARRAAEAAVNPQPTSFTEAGLPRRTPKAHLAPGSV
FT                   NTPPGDEGGRFERDAEHLRSRLASFQSGSQRGRHRAPDEG"
     atggcgaccg gtgacaccgg cagaggagcc gcggtcatca ggtggcgcaa ctggtcgctg        60
     acgaccaagc tcgccgccgt cgtgctcgtg ccggtgatct tcgcgatcac cctcggtgtc       120
     ggccagatcc gctggcaggt cgatagggcc gacgagtacg accgcgtggc caaggtgctc       180
     gacgcggtgg accagatcga gccgctggtg gtcagcgtcc aggaggagcg caccaggtcg       240
     gtggacttcc tcaccggctc gatcgacgcg ggcaaggtcg acgagcaggc cgtcgtggtc       300
     gacgccgcgg tgcggggcac ccgccaggtg atggcctccc ccgaggacta cagcgacgtg       360
     gtccgggagc gcttcggcga gctcaacacc gagctgggca agctcgacga gacccgcgcg       420
     ctggtccggg accggcgggc ccctgcgccc gcggtgatcg agcgctacag caagctggtg       480
     aactcgatcc tgtccctgaa ccgcgcgctg accagcaccg tcgccgaccg caacctctcc       540
     agcaccgcct ccgccatgca ggacatggtg tccatcatgg aggaagtgcg gctccagcag       600
     gcgtgggtgc tgaccggcct ggccgagggc agcatcagcc cccaggcgct ggaccagctg       660
     ctcggatcgc gggcccggct gatcggcaag atcagcgagg cccgggccac ggtggccgcg       720
     cactggcagc gccgcctcga ccagacgatg accggcacgg cgatcctcga gcgcaacaag       780
     ctggccaccg cgatcgtgct tgagaccacc gacggcaagt tctccggtgg ctactcggtc       840
     ccgcgcgacc agtggaacca gcgatccgac gaggtcatcc agctcatcga cgaaggccac       900
     gacgacctcg gcgccgaggt gcggcggatc gccttcgacc tggaggacga cgcgagcagc       960
     gcggcgggat gggactcggt cctgctgctg tcggcgctga tcctggccgc ggcgatcatc      1020
     atcaccatcg cccgccagct gctcggctcg ctgcgcgacc tgcggcgcgg tgcgctcaag      1080
     tcggccaaca agggcctgcc ggaggccgtg accagcatcc gcgcggggcg caaggtcgac      1140
     tccgagctcg agcccgtcgg cgtggacacc gacgaggagg tcgggcaggt ggcccgggcc      1200
     ttcgacgagg tcaaccggca ggcgctgcgc ctggcggtcg agcaggcctc gctgcggcgc      1260
     ggctacagcg aggcgttcgt ctcggtctcc cggcggagcc aggcgctgct ggaacgccag      1320
     ctccggctgt tcgaggagct ggagaaggac gaggaggacc ccgaccagct ctcccgcctg      1380
     ttccagctgg accacctcgc cacccggatg cgccggaaca acgagaacct gatggtgctc      1440
     tctggcagcg acctggcacg gcgcttctac cagccgaccg agctggccga cgtgctgcgc      1500
     gcggcggtgt cggagatcga gcagtacccg cgtgtcatcg tgcagccgcc gccggcggtc      1560
     aagctggtcg gccacgccgc cagcgacatg gtgcggctgg tcgccgagct gctggacaac      1620
     gcggcgaact tctcctcgcc ggacacctcg gtgacggtgt cgagctacca gtccggtgac      1680
     ggttcggtcg tgctcgacgt gctcgacgag ggcatcggca tgggccacgc ggagctggcc      1740
     tcggccaacg agcggctggc ccgggtcgac gaggacgacc tggcgacctc gcggcggatg      1800
     ggcctgttcg tggcgggccg cctggccgtc cgccacgaca tcggcgtcga gctgcacggc      1860
     ggccccgacg tcgagggtgt gcgcgccacg gtgacgattc cggccgagca cgtggtggcg      1920
     ggagacgcgg gccgcacggc tccgccgcct cccggacagg gcgtgcaccg caacggctcg      1980
     acccagcacg acctgccgaa cgcgacgtcg atccccgcgc agccggcggg cgacgaccag      2040
     ggcttcccgg cggccgactt cgacccgagc ccgtcgctgc cgcggcgcgg cgtctccgag      2100
     ccgaccgcgc gcgccgagtt cgagtcgagc gcgccgctgc cccgccggga tccgtcgggc      2160
     gggctgaacg ccctggactc cggttcgccg ctgccgaggc gggagccgcg cgagccctcg      2220
     ctccagcagg accacggtgc cccggcaacg gagggcgacc tctcggggcc ggcgccgctg      2280
     ttcgagccgt cgcaaccctc cgaggccgcc gaggagcagt cggagtccta cggggccgcg      2340
     cagcagattc cgccggagca gcccgcggag cagacggtga acctgttcac cccggagccc      2400
     ggcggcacgt cgctggacat accgcaccag ccgcgcacgg tcgggcagga cttcgcgccc      2460
     gcatggcccg cggtgaccga ggagcccccg cgcgaccagg tcgccgacac cagcgagtcg      2520
     ccgatcttcg aagaggtctc cacccagtgg ttccagcccg ccaccgacga cgcgcaggcg      2580
     cacgccacgt ccgggaccgc ggaacacgag ttcgcctggc cggactcggg tcagcgggac      2640
     cggtccgagg tggaggtcga cgagctggga ctgccggtcg gaccgggagc cgcggacggc      2700
     cttgcccgtt cggaccagcc gcgctcgccc ggccgctggg aggacgcggg gcagtcgccc      2760
     gcgccgagcg gctggagcga ggtgggtgag caccgctcgc ccagcggctg ggacgatgcg      2820
     gacctggcgc gttcgtccgg ggacgacgcc gacggggccc gctcgtccgg cggttggggc      2880
     gagtcgcgcg accccgaaga ctggagccgg tcggacgagt cccgctcctc cgatggctgg      2940
     gggctgggcg cagccaccgg ccaggtggag gcgggtgagc ccgcggaggt cggcatgagc      3000
     caggaaccag caccactgac cacgtcgggc ctgccccgcc gcacaccgcg cggcgcggcg      3060
     caggccgagg gcgcgggcaa ctcccgcagc gccagcgacg tgagcaggga gttctccgag      3120
     aagtacaacg gcgtccactt cggccagtcc gagccggccg cgcccgccga ggcaggcagc      3180
     gcggtcgagg acgcctggaa cttcgcagcc gacgacgccc ggcgggcggc cgaggccgcg      3240
     gtgaacccgc agcccacgtc gttcaccgag gcaggactgc cgcggcgcac cccgaaggcg      3300
     cacctcgcgc ccggcagcgt gaacacgcct cctggcgacg aaggcgggcg cttcgagcgc      3360
     gacgccgagc acctgcgcag tcgcctggcc agcttccaga gcggttccca gcgtggcagg      3420
     caccgcgcac ccgacgaggg atga                                             3444
//

If you have problems or comments...

PBIL Back to PBIL home page